BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e03f (546 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24110| Best HMM Match : Metallothionein (HMM E-Value=1.9) 29 3.3 SB_35467| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.6 >SB_24110| Best HMM Match : Metallothionein (HMM E-Value=1.9) Length = 237 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/71 (22%), Positives = 31/71 (43%) Frame = +1 Query: 58 HCVYLISCPVVQIKLS*CNVPHKIPATQACPLCQDRCRQIPGMECPCSLDLVSRPVKSHH 237 +C+YL+ + Q+K C V + + + C +CQ C C ++ V+ + Sbjct: 90 YCMYLVEYCMCQVKYCMCQVEYCMYQVEYC-MCQVEYCMCQVEYCMCQVEYCMCQVE--Y 146 Query: 238 RTCHITHASCQ 270 C + + CQ Sbjct: 147 CMCQVEYCMCQ 157 >SB_35467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 27.9 bits (59), Expect = 5.7 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Frame = +2 Query: 95 SNYHNATSLTKFRLPKHAH----YARTDAAKSRVWNAHAAWTWFPARSSPTTEHAT*RML 262 S+Y +ATS HAH YA ++ + V ++HA T A + + H T Sbjct: 255 SSYAHATSSFAHVTSSHAHVTTSYAHATSSYAHVTSSHAHATSSYAHVTTSYAHVTSSHA 314 Query: 263 HA-SSYNPENKQHNPAT 310 HA SSY H T Sbjct: 315 HATSSYAHVTSSHAHVT 331 >SB_21518| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 376 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = +2 Query: 116 SLTKFRLPKHAHYARTDAAKSRVWNAHAAWTWFPAR-SSPTTEHAT*RMLHASSYNPEN 289 S T F P+H ++ A + HA + FP+R S+ + A L + S++P+N Sbjct: 133 SPTSFVPPRHLGFSDPSMASGHSFMCHAQYDPFPSRLSTNASPVAMEPFLWSMSHSPQN 191 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,018,608 Number of Sequences: 59808 Number of extensions: 343839 Number of successful extensions: 884 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -