BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e02r (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 5.1 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 8.9 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 273 NTNLKLKKQYNAVKSDAEELRSAR 202 N +KLKK+ AVK E+ R R Sbjct: 188 NRRMKLKKELRAVKEINEQARRER 211 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 336 PPDKRRWAMRYTWNPQNNPVLNTNLKLKKQYNAVKSD 226 PP ++ + WN +N T++ L+K A K D Sbjct: 422 PPPEKLCVDQLIWNIRNIVYNQTSVTLRKHKAAYKGD 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 580,957 Number of Sequences: 2352 Number of extensions: 10757 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -