BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e02f (588 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 24 4.2 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 7.3 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 23.8 bits (49), Expect = 4.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 516 NTNLKLKKQYNAVKSDAEELRSAR 587 N +KLKK+ AVK E+ R R Sbjct: 188 NRRMKLKKELRAVKEINEQARRER 211 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +3 Query: 453 PPDKRRWAMRYTWNPQNNPVLNTNLKLKKQYNAVKSD 563 PP ++ + WN +N T++ L+K A K D Sbjct: 422 PPPEKLCVDQLIWNIRNIVYNQTSVTLRKHKAAYKGD 458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,786 Number of Sequences: 2352 Number of extensions: 10161 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -