BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d14r (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.1 Y17703-1|CAA76823.1| 111|Anopheles gambiae D7r1 protein protein. 25 1.5 AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 prote... 25 1.5 AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 prote... 25 1.5 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 24 4.5 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.1 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 517 TKNS*HLHHKAHNEEHSRLSAVH*H 591 T+N LHH+AH ++ + +H H Sbjct: 138 TRNGIVLHHQAHQQQQQQQQQLHHH 162 >Y17703-1|CAA76823.1| 111|Anopheles gambiae D7r1 protein protein. Length = 111 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 331 LFNKLILTGNLLCGIFVL 278 +FNKL L L CG+FV+ Sbjct: 1 MFNKLHLVSLLACGLFVI 18 >AY045760-1|AAK84942.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 331 LFNKLILTGNLLCGIFVL 278 +FNKL L L CG+FV+ Sbjct: 1 MFNKLHLVSLLACGLFVI 18 >AJ133852-1|CAB39727.1| 165|Anopheles gambiae D7-related 1 protein protein. Length = 165 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 331 LFNKLILTGNLLCGIFVL 278 +FNKL L L CG+FV+ Sbjct: 1 MFNKLHLVSLLACGLFVI 18 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 23.8 bits (49), Expect = 4.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = -3 Query: 507 YFSGCVTVERVNEKLTKFSFAFFRLTANIVPH 412 ++ GC +++ + +RLT+++VPH Sbjct: 183 WYEGCKATMADFQEINESGMQQYRLTSSLVPH 214 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,785 Number of Sequences: 2352 Number of extensions: 11811 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -