BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d14f (606 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0264 + 2030080-2031270 209 1e-54 01_02_0051 - 10655867-10657057 207 5e-54 01_03_0090 - 12347165-12348349 205 2e-53 12_02_0655 + 21588662-21589051 31 0.71 10_06_0022 - 9716537-9716649,9716709-9716826,9716958-9717076,971... 31 0.94 03_05_0640 - 26326832-26327166,26327295-26327529,26327665-263279... 29 2.2 10_06_0023 - 9727326-9727438,9727835-9727903,9727965-9728082,972... 29 3.8 06_03_1153 - 28047125-28047751 28 5.0 04_03_0847 - 20254736-20254933,20256127-20256201,20257538-202577... 28 6.6 >05_01_0264 + 2030080-2031270 Length = 396 Score = 209 bits (510), Expect = 1e-54 Identities = 97/155 (62%), Positives = 124/155 (80%), Gaps = 2/155 (1%) Frame = +2 Query: 146 FLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKANV 325 FLFTSESV EGHPDK+CDQ+SDA+LDA L +DPD+KVACET TKT MV++ GEIT+KANV Sbjct: 7 FLFTSESVNEGHPDKLCDQVSDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANV 66 Query: 326 DYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHEN--RNDEEVGAGDQ 499 DY+K+VRET ++IG+ + G D C V++ ++QQSP+IA GVH + + EE+GAGDQ Sbjct: 67 DYEKIVRETCRNIGFVSADVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQ 126 Query: 500 GLMFGYATDETEECMPLTVVLAHKLNQKIAELRRN 604 G MFGYATDET E MPL+ VLA KL ++ E+R+N Sbjct: 127 GHMFGYATDETPELMPLSHVLATKLGARLTEVRKN 161 >01_02_0051 - 10655867-10657057 Length = 396 Score = 207 bits (506), Expect = 5e-54 Identities = 97/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%) Frame = +2 Query: 128 MEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEI 307 M + FLFTSESV EGHPDK+CDQISDA+LDA L +DP++KVACET TKT MV++ GEI Sbjct: 1 MAEVDTFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPESKVACETCTKTNMVMVFGEI 60 Query: 308 TSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHEN--RNDEE 481 T+KANVDY+K+VR+T + IG+ + G D + C V++ ++QQSP+IA GVH + + EE Sbjct: 61 TTKANVDYEKIVRDTCRGIGFVSNDVGLDAEHCKVLVNIEQQSPDIAQGVHGHFTKRPEE 120 Query: 482 VGAGDQGLMFGYATDETEECMPLTVVLAHKLNQKIAELRRN 604 +GAGDQG MFGYATDET E MPL+ VLA KL ++ E+R+N Sbjct: 121 IGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKN 161 >01_03_0090 - 12347165-12348349 Length = 394 Score = 205 bits (501), Expect = 2e-53 Identities = 96/155 (61%), Positives = 121/155 (78%), Gaps = 2/155 (1%) Frame = +2 Query: 146 FLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKTGMVLLCGEITSKANV 325 FLFTSESV EGHPDK+CDQ+SDA+LDA L QDPD+KVACET TKT MV++ GEIT+KA V Sbjct: 6 FLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKATV 65 Query: 326 DYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHEN--RNDEEVGAGDQ 499 DY+K+VR+T + IG+ G D C V++ ++QQSP+IA GVH + + EE+GAGDQ Sbjct: 66 DYEKIVRDTCRGIGFVSDDVGLDADRCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQ 125 Query: 500 GLMFGYATDETEECMPLTVVLAHKLNQKIAELRRN 604 G MFGYATDET E MPL+ VLA KL ++ E+R+N Sbjct: 126 GHMFGYATDETPELMPLSHVLATKLGARLTEVRKN 160 >12_02_0655 + 21588662-21589051 Length = 129 Score = 31.1 bits (67), Expect = 0.71 Identities = 20/53 (37%), Positives = 24/53 (45%) Frame = +1 Query: 94 WIRENQRTQL*YGRWISIFVHIGICWRGSSRQNVRPNKRRYSRRAPESGSGRK 252 WI QR ++ G W RGS V P +RR SRR P SG R+ Sbjct: 27 WIGGRQRPRMWIGDWREE--------RGSVAVGVAPGRRRESRRRPGSGEARR 71 >10_06_0022 - 9716537-9716649,9716709-9716826,9716958-9717076, 9717238-9717476,9717793-9717849,9717933-9718019, 9718185-9718729,9718836-9719102 Length = 514 Score = 30.7 bits (66), Expect = 0.94 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +2 Query: 254 VACETITKTGMVLLCGEITSKANVDYQKVVRET--VKHIGYDDSSKGFDYKTCSVM 415 + C +I+K GM+L IT + D+ K VR+ KH GY KG +K+ + M Sbjct: 444 LVCGSISKVGMLLF---ITLRT--DWGKEVRKPSPYKHFGYHGKRKGLQFKSSNSM 494 >03_05_0640 - 26326832-26327166,26327295-26327529,26327665-26327908, 26328389-26328507,26328860-26329050,26329133-26329220, 26331653-26331715,26331816-26333944,26334084-26334186 Length = 1168 Score = 29.5 bits (63), Expect = 2.2 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = +2 Query: 131 EDGSVFLFTSESVGEGHPDKM---CDQISDAILDAHLNQDPDAKVACETITKTGMVLLC 298 +DGS +LFTS+ E HP M D+ S+ IL E I K G L C Sbjct: 765 QDGSEWLFTSKRTDESHPFTMHVNFDKFSEDILVGDELVIDGGMATFEVIEKVGNDLRC 823 >10_06_0023 - 9727326-9727438,9727835-9727903,9727965-9728082, 9728232-9728350,9728506-9728695 Length = 202 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 254 VACETITKTGMVLLCGEITSKANVDYQKVVRET--VKHIGYDDSSKGFDYKTCSVM 415 + C +I+K GM+L IT + D+ K V++ KH GY KG +K + M Sbjct: 109 IVCGSISKVGMLLF---IT--LHTDWGKEVQKASPCKHFGYHAERKGLQFKYSNSM 159 >06_03_1153 - 28047125-28047751 Length = 208 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/49 (26%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +1 Query: 148 FVHIGICWRG-SSRQNVRPNKRRYSRRAPESGSGRKSCM*NHN*NRYGA 291 +++ CW+ ++ P Y R P +G GR +H+ + YGA Sbjct: 106 YIYRSQCWKSLKKKKKPPPPLPLYRPRPPPAGDGRPDVTVHHHHHHYGA 154 >04_03_0847 - 20254736-20254933,20256127-20256201,20257538-20257717, 20257802-20257869,20258563-20259125,20259198-20259235 Length = 373 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 595 ELCNFLIEFVCKHYSQRHAFFC 530 E+ +FL+ +H +QRHAF C Sbjct: 87 EVIDFLLALPSRHPAQRHAFLC 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,858,593 Number of Sequences: 37544 Number of extensions: 399667 Number of successful extensions: 1102 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1442939384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -