BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d13f (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0629 + 5464282-5464304,5464367-5465528 33 0.26 09_04_0528 - 18348071-18348136,18348477-18351209 30 1.9 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 28 7.5 >08_01_0629 + 5464282-5464304,5464367-5465528 Length = 394 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/54 (27%), Positives = 31/54 (57%) Frame = +2 Query: 23 IWDVLEYLLELNRKESRVIIIRNEFNRVQVLHGKNSGLDVEQQNDSVSFITVIL 184 ++D LE L + R +++ RN F+R +++HGK + +N +S++ +L Sbjct: 142 LFDCLENLADSGRSLLLMVLWRNWFSRNEIMHGKPAPTIEASKNFLLSYVNTLL 195 >09_04_0528 - 18348071-18348136,18348477-18351209 Length = 932 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 29 DVLE-YLLELNRKESRVIIIRNEFNRVQVL 115 DV E YL EL R+ ++ RN FNR+Q L Sbjct: 481 DVAEGYLTELVRRSMIQVVARNSFNRIQCL 510 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 217 CPANANVETNKQNDSNERNTIVLLFNIQ 134 CP V+ K++ SNER+++VL Q Sbjct: 592 CPGKGRVQDKKKSVSNERSSVVLSVEAQ 619 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,599,039 Number of Sequences: 37544 Number of extensions: 226191 Number of successful extensions: 672 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 672 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -