BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d13f (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) 32 0.36 SB_40986| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) 29 2.5 SB_46613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_16299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_3278| Best HMM Match : ORC2 (HMM E-Value=0) 29 4.4 >SB_50057| Best HMM Match : NACHT (HMM E-Value=1.4e-08) Length = 1555 Score = 32.3 bits (70), Expect = 0.36 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -3 Query: 277 TEDVVKRCLRSSTSAVSRFLCPANANVETNKQNDSNERNTIV 152 T + K + ++T+A+SR++ N N+ NK D N N+ V Sbjct: 1235 TFTITKTPITTTTTALSRYVNNNNNNIHHNKNTDDNNNNSFV 1276 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 268 VVKRCLRSSTSAVSRFLCPANANVETNKQNDSNERNTIV 152 + K + + T+A+SR++ N ++ NK D N N+ V Sbjct: 1516 ITKTPMTTITTALSRYVNNNNNDIHHNKNTDDNNNNSFV 1554 >SB_40986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 262 KRCLRSSTSAVSRFLCPANANVETNKQNDSNERNTIV 152 K + ++T+A+SR++ N N+ NK D N N+ V Sbjct: 23 KTPMTTTTTALSRYVNNNNNNIHHNKNTDDNNNNSFV 59 >SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 253 LRSSTSAVSRFLCPANANVETNKQNDSNERNTIV 152 + ++T+A+SR++ N N+ NK D N N+ V Sbjct: 1 MTTTTTALSRYVNNNNNNIHHNKNTDDNNNNSFV 34 >SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1471 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 268 VVKRCLRSSTSAVSRFLCPANANVETNKQNDSNERNTIV 152 + K + ++T+A+SR++ N ++ NK D N N+ V Sbjct: 145 ITKTPMTTTTTALSRYVNNNNNDIHHNKNTDDNNNNSFV 183 >SB_35403| Best HMM Match : Lectin_C (HMM E-Value=1e-05) Length = 2293 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 212 RAEESAHGRGGRSQAPFDHVFCSGN-YNTNQRRHNNYYRRSDYYRFNNYYY 361 + + +G GG + ++ + N Y TN + NNYY+ Y N Y Y Sbjct: 1406 QGNNNMYGYGGNNNVYMNNGYQGNNLYTTNSYQGNNYYQNKGYQ--NGYRY 1454 >SB_46613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/56 (28%), Positives = 23/56 (41%) Frame = +2 Query: 203 SVGRAEESAHGRGGRSQAPFDHVFCSGNYNTNQRRHNNYYRRSDYYRFNNYYYGCS 370 S GR+ E+ H R + N N N +R +N + D +N YY S Sbjct: 134 SYGRSHENLHADCNRKSKSLESCADLKNANNNDQRPSNPMFKEDLQNDSNTYYASS 189 >SB_16299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 317 SCCVYVDWCCSFQNRRRGQTVPEIVH 240 SCCV+ ++ + NR+RG +P VH Sbjct: 141 SCCVFCEFSPHYPNRKRGLFLPCKVH 166 >SB_3278| Best HMM Match : ORC2 (HMM E-Value=0) Length = 459 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 420 TEPPVSEGNNPVEENKENGVGKDDENLFPLVVKDKSL 530 TE +GN+ ++NKE GKDDE+ ++ K+L Sbjct: 76 TEDDTDDGND--DDNKEGSSGKDDESENEKIIVPKAL 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,492,150 Number of Sequences: 59808 Number of extensions: 288246 Number of successful extensions: 921 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 905 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -