BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d12f (599 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding pr... 27 0.46 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 24 4.3 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 24 4.3 >AY146743-1|AAO12103.1| 192|Anopheles gambiae odorant-binding protein AgamOBP11 protein. Length = 192 Score = 27.1 bits (57), Expect = 0.46 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 220 FHLGKYCETINNEYMLCRQEENDP 291 F LG+ CE +N +++C Q+ + P Sbjct: 121 FGLGECCENFSNRHLVCLQQNSLP 144 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 304 NEGKAVTACTLEFFRKV---KKTCLAEFNQYSNCLDKSSG 414 N A T L+ +K+ K TC ++ + NC +S G Sbjct: 234 NPNNAQTVACLQNQKKLACKKSTCQQAYDTFQNCFGESRG 273 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.8 bits (49), Expect = 4.3 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 304 NEGKAVTACTLEFFRKV---KKTCLAEFNQYSNCLDKSSG 414 N A T L+ +K+ K TC ++ + NC +S G Sbjct: 234 NPNNAQTVACLQNQKKLACKKSTCQQAYDTFQNCFGESRG 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 606,114 Number of Sequences: 2352 Number of extensions: 12296 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -