BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d08f (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g32400.2 68414.m03998 senescence-associated family protein co... 34 0.064 At1g32400.1 68414.m03997 senescence-associated family protein co... 34 0.064 At5g13150.1 68418.m01506 exocyst subunit EXO70 family protein le... 30 1.0 At3g56580.2 68416.m06292 zinc finger (C3HC4-type RING finger) fa... 30 1.0 At3g56580.1 68416.m06291 zinc finger (C3HC4-type RING finger) fa... 30 1.0 At5g55020.1 68418.m06853 myb family transcription factor (MYB120... 29 2.4 At3g04290.1 68416.m00454 GDSL-motif lipase/hydrolase family prot... 28 4.2 At1g28695.1 68414.m03534 expressed protein ; expression supporte... 28 5.5 At3g02890.1 68416.m00284 PHD finger protein-related contains low... 27 7.3 At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family pr... 27 7.3 At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) ... 27 9.6 At1g78420.1 68414.m09138 expressed protein 27 9.6 At1g49330.1 68414.m05529 hydroxyproline-rich glycoprotein family... 27 9.6 >At1g32400.2 68414.m03998 senescence-associated family protein contains Pfam profile PF00335: Tetraspanin family Length = 280 Score = 34.3 bits (75), Expect = 0.064 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 261 VGGIAFVIAFFGCCGAIRESNCMLVTYAIFMLVLMALKLTLGVMVF 398 +G FVI+ GC G S C L Y++ +++L+ ++L +F Sbjct: 88 IGVALFVISCCGCVGTCSRSVCCLSCYSLLLILLILVELGFAAFIF 133 >At1g32400.1 68414.m03997 senescence-associated family protein contains Pfam profile PF00335: Tetraspanin family Length = 280 Score = 34.3 bits (75), Expect = 0.064 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 261 VGGIAFVIAFFGCCGAIRESNCMLVTYAIFMLVLMALKLTLGVMVF 398 +G FVI+ GC G S C L Y++ +++L+ ++L +F Sbjct: 88 IGVALFVISCCGCVGTCSRSVCCLSCYSLLLILLILVELGFAAFIF 133 >At5g13150.1 68418.m01506 exocyst subunit EXO70 family protein leucine zipper-containing protein - Lycopersicon esculentum, EMBL:Z12127 contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 653 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -1 Query: 395 HHYAQGQFQCHQHQHEDRVGDKHAVALPDGTAASEERNNE 276 HH+A + H H+ ED +H+ L T S+ ++E Sbjct: 7 HHHANESSENHDHKSEDHENKQHSDELHSSTPESQSESSE 46 >At3g56580.2 68416.m06292 zinc finger (C3HC4-type RING finger) family protein contains INTERPRO domain, IPR001841, RING finger Length = 320 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 431 RDSSNYSV--EIHKHHYAQGQFQCHQHQHEDR 342 RD++N + E H HH+ Q Q Q HQHQH+ + Sbjct: 277 RDTNNTATAEEGHYHHHQQQQQQ-HQHQHQQQ 307 >At3g56580.1 68416.m06291 zinc finger (C3HC4-type RING finger) family protein contains INTERPRO domain, IPR001841, RING finger Length = 320 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -1 Query: 431 RDSSNYSV--EIHKHHYAQGQFQCHQHQHEDR 342 RD++N + E H HH+ Q Q Q HQHQH+ + Sbjct: 277 RDTNNTATAEEGHYHHHQQQQQQ-HQHQHQQQ 307 >At5g55020.1 68418.m06853 myb family transcription factor (MYB120) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 523 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 461 VLLEGL-VHPVRDSSNYSVEIHKHHYAQGQFQCHQHQHEDR 342 +L +GL ++P N+ + H HH Q Q H H H+ + Sbjct: 129 LLRQGLPLYPPDIIPNHQLHPHPHHQQQQQHNHHHHHHQQQ 169 >At3g04290.1 68416.m00454 GDSL-motif lipase/hydrolase family protein similar to family II lipases EXL3 GI:15054386, EXL1 GI:15054382, EXL2 GI:15054384 from [Arabidopsis thaliana]; contains Pfam profile: lipase/acylhydrolase with GDSL-like motif Length = 366 Score = 28.3 bits (60), Expect = 4.2 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 375 LTLGVMVFVNLDGVVAAIPNWMNKTFQQDQDTFHVIEHRFSCCGPTGPGSYLSLTLPIT 551 L V + D VAA MN + + + F + + +CCG GP + + L P++ Sbjct: 256 LIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCG-QGPYNGIGLCTPVS 313 >At1g28695.1 68414.m03534 expressed protein ; expression supported by MPSS Length = 329 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 491 IQLLWSNGSGLVPILDPAHNVLLDDPLYGNQRVRRLH 601 ++ W G G +P+LD V +D Y R +RLH Sbjct: 84 LESFWE-GEGTLPLLDHLMVVAVDQTAYDRCRFKRLH 119 >At3g02890.1 68416.m00284 PHD finger protein-related contains low similarity to PHD-finger domain proteins Length = 963 Score = 27.5 bits (58), Expect = 7.3 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 401 HKHHYAQGQFQCHQHQHEDRVGDKHAVALPDGTAASEERNNECDASNNHTGHR 243 HK + C+ HQ +G + V G +EE+ N S+ H+G R Sbjct: 114 HKDQDSMKVDSCNDHQARSTLG-QGKVKEKSGAKNNEEKKNTLTGSSKHSGPR 165 >At1g27740.1 68414.m03390 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 258 Score = 27.5 bits (58), Expect = 7.3 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -1 Query: 365 HQHQHEDRV--GDKHAVALPD 309 HQHQH + V D HA LPD Sbjct: 45 HQHQHHNNVLSSDHHAFLLPD 65 >At3g14400.1 68416.m01822 ubiquitin-specific protease 25 (UBP25) similar to GI:11993490 Length = 661 Score = 27.1 bits (57), Expect = 9.6 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 425 SSNYSVEIHKHHYAQGQFQCHQHQHEDRVGDKHAVALPDGTAASE-ERN 282 SSN+ V +H H + G H H+D + + +GTA E ERN Sbjct: 498 SSNHKVALHPHERSNGSSNGGDH-HKDNLHPCGSNGSQNGTAHPETERN 545 >At1g78420.1 68414.m09138 expressed protein Length = 401 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = -1 Query: 380 GQFQCHQHQHEDRVGDKHAVALPDGTAASEERNNECDASNNHTGHRRYPEAG 225 G+ H H H V LP + + E D +NH HR + E G Sbjct: 289 GESSSHNHNHNVNVSSYSM--LPGNCDSYYDIEQEVDGIDNHHHHRHHYEMG 338 >At1g49330.1 68414.m05529 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 331 Score = 27.1 bits (57), Expect = 9.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +3 Query: 426 IPNWMNKTFQQDQDTFHVIEHRFSCCGPTGPGSYLS 533 IP WM+ FQQ + ++ H F G P S L+ Sbjct: 104 IPLWMSNYFQQTPNPPQLVTHFFPPSGLAPPSSNLT 139 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,170,910 Number of Sequences: 28952 Number of extensions: 282299 Number of successful extensions: 829 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -