BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d07f (466 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1 |Schizosa... 26 2.5 SPAC17A5.10 |||conserved fungal protein|Schizosaccharomyces pomb... 25 4.3 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 5.7 SPAC1687.15 |gsk3|skp1|serine/threonine protein kinase Gsk3|Schi... 25 5.7 SPAC1952.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 7.5 SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosa... 24 9.9 >SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 26.2 bits (55), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 251 GAVYLTLTACELAVAARVTTKLRNS 177 G + + TACE +AARV KL+ S Sbjct: 328 GVMDVRTTACEALLAARVEQKLKGS 352 >SPAC17A5.10 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 224 Score = 25.4 bits (53), Expect = 4.3 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 282 PGSRGVPVRDCPPCRGRGRFNF 347 PG +P R C C+G G+ +F Sbjct: 185 PGDPRIPGRVCGNCKGSGQLDF 206 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 25.0 bits (52), Expect = 5.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 279 SDGPDASTGGRRVPHVDSLRAGCRSTSHNEAP*QSIIWS 163 S GP S + +V+S G STS+N+ P QS+ S Sbjct: 324 SSGP--SYHAEQEVNVNSYNGGIPSTSYNDTPQQSVTGS 360 >SPAC1687.15 |gsk3|skp1|serine/threonine protein kinase Gsk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.0 bits (52), Expect = 5.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 Query: 303 LGHPYFPGSDGPD 265 LGHP FPG G D Sbjct: 228 LGHPLFPGESGID 240 >SPAC1952.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 24.6 bits (51), Expect = 7.5 Identities = 10/35 (28%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 333 PAPDKADSRELGHPYFPGSDGPDASTGG-RRVPHV 232 P P++ ++ H +FPGS R PH+ Sbjct: 73 PTPERPEASAQQHAFFPGSSSQQTDIPNVRPQPHI 107 >SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosaccharomyces pombe|chr 3|||Manual Length = 1213 Score = 24.2 bits (50), Expect = 9.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 87 DCGQHEQKSELHLVAKK 37 D H++KSE+H+V +K Sbjct: 574 DLNNHQEKSEVHVVIEK 590 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,623,716 Number of Sequences: 5004 Number of extensions: 26861 Number of successful extensions: 69 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -