BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d04r (491 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) 209 1e-54 SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 1.6 SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) 29 2.8 SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) 29 2.8 SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) 27 6.4 SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_30314| Best HMM Match : CBS (HMM E-Value=2.1) 27 8.4 >SB_31444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 209 bits (510), Expect = 1e-54 Identities = 101/145 (69%), Positives = 123/145 (84%) Frame = -3 Query: 441 MKFNKQVTSSRRKNRKRHFRAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 262 MK N +V+SSRRK+RK HF APS +RR LMS+PLSKELRQK+NV+S+P+RKDDEVQV RG Sbjct: 1 MKRNSEVSSSRRKSRKAHFSAPSSVRRKLMSAPLSKELRQKYNVRSIPVRKDDEVQVTRG 60 Query: 261 HYKGQQVGKVMQVYRKKFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILD 82 H+K QQVGKV+QVYRKK+V++I+RIQREKANGAT VGIHPSK IVKLK++KDRK ILD Sbjct: 61 HFKSQQVGKVIQVYRKKWVIHIDRIQREKANGATVSVGIHPSKVEIVKLKIDKDRKKILD 120 Query: 81 RRAKGRLAALGKDKGKYTEETATAM 7 R+ + +LA +KGK+TEE AM Sbjct: 121 RKNRSKLA----EKGKHTEEEVQAM 141 >SB_56015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.3 bits (70), Expect = 0.22 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 441 MKFNKQVTSSRRKNRKRHFRAPSHIRRVLMSSPLSKELRQKFNVKSMP--IRK 289 MK + Q+ RK+ K H + P HIR+ S + K +R+ N + P IRK Sbjct: 1 MKTHSQIQKHTRKS-KTHSQIPKHIRKSKTHSQIQKHIRKSKNTLANPKHIRK 52 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 114 KMNKDRKAILDRRAKGRLAALGKDKGKYTEETA 16 ++NK R I + R + L+ G DKG+Y +E A Sbjct: 270 RLNKYRNKIFEARGRVILSQHGTDKGEYVQEVA 302 >SB_56863| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4248 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/55 (29%), Positives = 24/55 (43%) Frame = -2 Query: 169 WCNSICRHSPFKVCDCQVEDE*RPQSNPRSQSKGQTGCTWQRQG*IHRGNCHSHG 5 W N IC ++C C+V DE N + ++ G TW R +R + G Sbjct: 525 WHNRICMR--VEICGCKVCDEPLGMENSKIKANDIEGHTWTRNREPYRARLNYRG 577 >SB_19506| Best HMM Match : Viral_helicase1 (HMM E-Value=2.7) Length = 828 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 78 CDRGLLCGLYSSST*QSHTLKGE-CRHMLLHHWP--FLFESSQCIQQTFYD 221 C G + + ST + L+G+ CR M+L HWP F + + + +T D Sbjct: 325 CKNGKVPVVSGGSTYDTWPLQGDFCRTMMLLHWPNWFSLDELESVDETSKD 375 >SB_16484| Best HMM Match : MSG (HMM E-Value=0.24) Length = 661 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 1 GLHGCGSFLGVFTLVFAKCSQS 66 GLH CG + VFAKC Q+ Sbjct: 74 GLHPCGDLVPTMLKVFAKCDQA 95 >SB_27754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +1 Query: 175 LFSLNPLNVYNKLFTIHLHHFANLLAFVVSTYNLNFIVFAN 297 L +++ ++YN+L +H+ H N L V T+ N +V A+ Sbjct: 338 LVAVHVTHLYNRLVAVHVTHLYNRLVAVHVTHLYNRLVAAH 378 >SB_27917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4554 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 466 CRFGEERQNEVQQAGDFLKKEKQEEAF 386 C F EER QQ G K E+ ++AF Sbjct: 2583 CPFTEERMESFQQIGRTAKSEESDKAF 2609 >SB_50053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 959 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = -3 Query: 375 SHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQ--VVRGHYKGQQVGKVMQVYRK 214 + ++++ + + K LR+ K+MP R+D+++Q V YK ++VG+ + R+ Sbjct: 139 NEVKQLGNGNNMEKILREFIKKKNMPKREDEKLQGNVSGRDYKNKKVGQKSEEQRE 194 >SB_21731| Best HMM Match : Ribosomal_L13e (HMM E-Value=7.2) Length = 606 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 435 FNKQVTSSRRKNRKRHFRAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDD 283 F+ S +K+ +R+F +HI + + +S SK+ ++ K + DD Sbjct: 124 FSTSQASRPKKSNRRYFPTSNHIAKAISASRYSKDDQESLKRKVEEWQTDD 174 >SB_40034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 37 TLVFAKCSQSALCSAIEDCFAVFI 108 T+ + C + + CS I DCF VFI Sbjct: 221 TMPLSFCQKFSSCSVIIDCFEVFI 244 >SB_30314| Best HMM Match : CBS (HMM E-Value=2.1) Length = 869 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 175 LFSLNPLNVYNKLFTIHLHHFANLLAFVVSTYNLNFIVFANR 300 L S+N L N+L TI+L NLL + ++N ++ NR Sbjct: 503 LLSINRLLSINRLLTINLLLSINLLLSINRLLSINLLLSINR 544 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,762,765 Number of Sequences: 59808 Number of extensions: 344507 Number of successful extensions: 1045 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -