BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d04r (491 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49910.1 68416.m05456 60S ribosomal protein L26 (RPL26A) 60S ... 194 4e-50 At5g67510.1 68418.m08513 60S ribosomal protein L26 (RPL26B) 189 1e-48 At1g50500.1 68414.m05664 membrane trafficking VPS53 family prote... 27 5.2 At2g04920.1 68415.m00513 F-box family protein (FBX9) identical t... 27 9.1 >At3g49910.1 68416.m05456 60S ribosomal protein L26 (RPL26A) 60S RIBOSOMAL PROTEIN L26, Brassica rapa, EMBL:BRD495 Length = 146 Score = 194 bits (472), Expect = 4e-50 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 1/141 (0%) Frame = -3 Query: 441 MKFNKQVTSSRRKNRKRHFRAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 262 MK+N +VTSSRRKNRK HF A S RRV+MSSPLS +LRQK+NV+SMPIRKDDEVQ+VRG Sbjct: 1 MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRG 60 Query: 261 HYKGQQVGKVMQVYRKKFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILD 82 YKG++ GKV+QVYR+K+V++IERI REK NG T VGI PSK VI KL+++KDRK++L+ Sbjct: 61 TYKGRE-GKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVITKLRLDKDRKSLLE 119 Query: 81 RRAKGRLAALGKDKG-KYTEE 22 R+AKGR AA K+KG K+T E Sbjct: 120 RKAKGR-AAADKEKGTKFTSE 139 >At5g67510.1 68418.m08513 60S ribosomal protein L26 (RPL26B) Length = 146 Score = 189 bits (460), Expect = 1e-48 Identities = 93/141 (65%), Positives = 119/141 (84%), Gaps = 1/141 (0%) Frame = -3 Query: 441 MKFNKQVTSSRRKNRKRHFRAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 262 MKFN +V+SSRRKNRK HF APS +RRVLMSSPLSK+LR K NV+SMPIRKDDEVQVVRG Sbjct: 1 MKFNPRVSSSRRKNRKAHFTAPSSVRRVLMSSPLSKDLRNKHNVRSMPIRKDDEVQVVRG 60 Query: 261 HYKGQQVGKVMQVYRKKFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILD 82 +KG++ GKVMQVYR+K+V++IERI REK NG+T VG++ S +I KL+++KDRK++L+ Sbjct: 61 TFKGRE-GKVMQVYRRKWVIHIERITREKVNGSTVNVGVNASNVMITKLRLDKDRKSLLE 119 Query: 81 RRAKGRLAALGKDKG-KYTEE 22 R+A GR AA K+KG K++ E Sbjct: 120 RKANGR-AAADKEKGTKFSAE 139 >At1g50500.1 68414.m05664 membrane trafficking VPS53 family protein contains Pfam domain PF04100: Vps53-like, N-terminal Length = 798 Score = 27.5 bits (58), Expect = 5.2 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -3 Query: 336 KELRQKFNVKSMPIR--KDDEVQVVRGHYKGQQVGKVMQVYRKKFVVYIERIQREK 175 KEL +KF +P + +DD ++ Q + K+ + Y KKF E + EK Sbjct: 315 KELEKKFG-GGVPTKDIEDDIEEIGTWEDNSQNISKIRKKYEKKFAASQETEENEK 369 >At2g04920.1 68415.m00513 F-box family protein (FBX9) identical to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains F-box domain PF:00646; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 376 Score = 26.6 bits (56), Expect = 9.1 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 4/83 (4%) Frame = -3 Query: 477 VLSRVVLAKSDRMKFNKQVTSSRRKNRK---RHF-RAPSHIRRVLMSSPLSKELRQKFNV 310 +LSRV R++F + +S KNR+ +HF +AP +L + N Sbjct: 12 ILSRVPATSLKRLRFTCKQWNSLFKNRRFTEKHFCKAPKQSHVLLWKDYTVCPMSINLNF 71 Query: 309 KSMPIRKDDEVQVVRGHYKGQQV 241 I + + HY +QV Sbjct: 72 SGSSIEFKSVLSLKDSHYNSEQV 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,780,963 Number of Sequences: 28952 Number of extensions: 230488 Number of successful extensions: 657 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 858708096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -