BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d02r (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0146 + 4953007-4953297,4954105-4954341,4954592-4954669,495... 28 8.5 >09_02_0146 + 4953007-4953297,4954105-4954341,4954592-4954669, 4954991-4955167,4955705-4955761,4955988-4956174, 4956910-4957055,4957213-4957395,4957860-4957970, 4959386-4959505,4959596-4959740,4960001-4960164, 4960816-4960902,4961062-4961390,4963426-4963507, 4963616-4963746,4963976-4964225,4965112-4965393, 4966780-4966986 Length = 1087 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 2/38 (5%) Frame = +2 Query: 533 SVIIRH*TTTET--STLKIIKSHLYLIIKFWSLPLMTL 640 S+I+RH T +LKIIK++ +I+ F ++PL+ L Sbjct: 781 SMIVRHFLTLSLPFQSLKIIKNNPSIIVAFATIPLVCL 818 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,013,891 Number of Sequences: 37544 Number of extensions: 233142 Number of successful extensions: 383 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -