BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11d02r (716 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.7 >SB_8762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +2 Query: 428 HLCLLRISKDHLLRFYTVTKPSPATTTN--LILSDFGSVIIRH*TTTETSTL 577 H L SK H+LR +T TT +++S GSV+ H T TETS + Sbjct: 173 HQGLKSHSKVHVLRTQGITSDGDCVTTTETVVISSTGSVV-SHNTYTETSPM 223 >SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 551 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 397 YTVLTNTRLNTSMSSENLKRSSTPFLYSNKAFS 495 YT++ N++ ++S SS + SS+P L+ AF+ Sbjct: 334 YTIINNSKSSSSSSSSSPSLSSSPSLFLPLAFT 366 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,345,445 Number of Sequences: 59808 Number of extensions: 314051 Number of successful extensions: 574 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -