BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c23r (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0529 - 19107949-19108152,19108857-19109147,19109817-191099... 28 3.3 12_01_0189 + 1397068-1397241,1397713-1397804,1398456-1398546,139... 27 5.8 03_05_0495 - 24907659-24908747 27 5.8 >07_03_0529 - 19107949-19108152,19108857-19109147,19109817-19109939, 19110019-19110306 Length = 301 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -2 Query: 344 IRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTILQAYEYIEASFTIADR 183 + + V + +HH ++ Q + L I+ +F++LQ Y Y A ++ ADR Sbjct: 240 VLAAVGIIQSHHFWLDVEHIQEAIQNVLVIIEMVFFSVLQQYAYHVAPYSGADR 293 >12_01_0189 + 1397068-1397241,1397713-1397804,1398456-1398546, 1398931-1399052,1399142-1399289,1399596-1399665, 1400465-1400517,1400678-1400822,1401308-1401426, 1401480-1401527,1401528-1401599,1401902-1402024, 1402025-1402131,1402437-1402547,1402585-1402777, 1402959-1403129,1403548-1403673 Length = 654 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 315 SSLIDRK*LLTNKTKIIFNYFIRILFYYFTS 223 SSL R+ + + K++ NY+ ILF F S Sbjct: 393 SSLASRRPRILDTQKVLINYYAMILFQVFVS 423 >03_05_0495 - 24907659-24908747 Length = 362 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = -2 Query: 179 YGSTFFIATGFHGIHVI----IGTLFLLICYIRHLNNHFSKNHHF 57 +GS FF+ T H I V+ + F L C I+ ++ + + H+F Sbjct: 238 FGSQFFVLTRKHAIMVVRDMKLWRKFKLPCLIKRRDSCYPEEHYF 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,681,409 Number of Sequences: 37544 Number of extensions: 163291 Number of successful extensions: 311 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 306 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -