BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c22r (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59726| Best HMM Match : Keratin_B2 (HMM E-Value=5.9) 29 3.8 SB_4846| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_15927| Best HMM Match : fn2 (HMM E-Value=3.9) 28 8.9 >SB_59726| Best HMM Match : Keratin_B2 (HMM E-Value=5.9) Length = 319 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 258 TNVVYMFPYKHLRNLSGEMVGSSAQIIKAHFLPIRY 151 TN ++ PYKH + + + +SA+ AH +P ++ Sbjct: 37 TNTAHIIPYKHCPHQPVQTLPTSARTNTAHIIPYKH 72 >SB_4846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -3 Query: 258 TNVVYMFPYKHLRNLSGEMVGSSAQIIKAHFLPIRYSTKLL*HNTDIHLN 109 TN ++ PYKH + + + +SA+ AH P ++ L H++ Sbjct: 381 TNTAHISPYKHCPHQPVQTLPTSARTNTAHISPYKHCLLTLARTNTAHIS 430 >SB_15927| Best HMM Match : fn2 (HMM E-Value=3.9) Length = 343 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -3 Query: 258 TNVVYMFPYKHLRNLSGEMVGSSAQIIKAHFLPIRY 151 TN ++ PYKH + + + +SA + AH P ++ Sbjct: 186 TNTAHISPYKHCPHQPVQTLPTSASVNTAHISPCKH 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,468,536 Number of Sequences: 59808 Number of extensions: 387120 Number of successful extensions: 569 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -