BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c20r (536 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein lig... 29 0.33 SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces p... 25 7.2 >SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1647 Score = 29.5 bits (63), Expect = 0.33 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +1 Query: 175 DNGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGNSRSNDNRSGLHGSSH 354 + G FS+ + L SGS+RN+SGD T S D+ + H H Sbjct: 1023 ETGRRFSILREAGSLRESMSGSSRNSSGDYTDSMSQDAPNHTTEPSERRDSSTSSHFEEH 1082 Query: 355 Y 357 + Sbjct: 1083 F 1083 >SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 262 VDVHDELHKRRGTGGNSRSNDNR 330 +D D + K RG GG SND R Sbjct: 394 IDEIDAIGKARGRGGQFGSNDER 416 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,075,034 Number of Sequences: 5004 Number of extensions: 14915 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -