BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c16r (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 25 1.8 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.3 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 3.1 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.4 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 7.2 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 9.5 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.4 bits (53), Expect = 1.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 713 VXAAVPAKRGHYESPDVGPALVEAPIVPSP 624 V +P ++ H D GPAL API P Sbjct: 135 VRPLLPQQQQHPHQRDTGPALFPAPISHRP 164 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 327 HDHGGHQGHVTNVHWARGHNGGVSHDH 407 H H H G+ + G +GG +HDH Sbjct: 124 HHHHHHHGNNGGGNGGGGGSGGNAHDH 150 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 691 NVDTTRAQMSVLP*SKLPSSHP 626 N+ T + VLP SK+P+S+P Sbjct: 31 NIRTGANNIGVLPASKMPTSYP 52 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 505 TFDCSGSTLSTGVALAASLMLIRMWTRGV 591 T CS TGV + S++L RM GV Sbjct: 1160 TVHCSAGVGRTGVFITLSIVLERMQYEGV 1188 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 7.2 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -1 Query: 677 ESPDVGPALVEAPIVPSPVHVG---PLVPGQLTP 585 +S GP A + PSP G PL PG +TP Sbjct: 439 QSTSPGPDRSPATLTPSPGIGGPISPLDPGNVTP 472 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 118 NQLSLLIISKI*KNNQMTSSTCGFYMEI*FTKIYQVS 8 N+ L+ + +I KN+ F ++I T IY+ S Sbjct: 35 NEFDLMFVKEIFKNHNSNVVLSPFSVKILLTLIYEAS 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 516,506 Number of Sequences: 2352 Number of extensions: 8309 Number of successful extensions: 24 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -