BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c11r (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 36 0.025 SB_766| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_16976| Best HMM Match : Collagen (HMM E-Value=4.1e-11) 32 0.40 SB_55803| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 29 3.8 SB_21625| Best HMM Match : VAR1 (HMM E-Value=6.3) 29 3.8 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_6496| Best HMM Match : Collagen (HMM E-Value=0) 28 6.6 SB_35384| Best HMM Match : PRA1 (HMM E-Value=6.7) 28 6.6 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 28 6.6 SB_15668| Best HMM Match : Chorion_3 (HMM E-Value=2.5) 28 6.6 SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_36009| Best HMM Match : Collagen (HMM E-Value=0) 28 8.7 SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) 28 8.7 SB_29801| Best HMM Match : Collagen (HMM E-Value=3.2e-12) 28 8.7 >SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 36.7 bits (81), Expect = 0.019 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%) Frame = -1 Query: 714 LWCKDGKKVSTTLLQVVDNHVIKYIPPEEYKPMIKSNVKWVEKQKYGCILVGAEN-IDPS 538 LW KDG+++ TL+Q+ D V+ + + + Q + VGA N ++ + Sbjct: 383 LWLKDGRRLPVTLIQIKDCEVV--------QARVAKGHGGRDPQTE--LQVGAVNKLELN 432 Query: 537 VVTKDYCGIFDSVGMLPKRHLCRFVVSPESALPNG 433 + K G F + PKR +C F V+P++ L G Sbjct: 433 QIGKAQFGHFKRFSVRPKRKVCSFPVTPDALLTPG 467 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 36.3 bits (80), Expect = 0.025 Identities = 31/91 (34%), Positives = 38/91 (41%) Frame = -1 Query: 444 LPNGTPLYATHFRVGDCIDIRSKTMDRGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSG 265 L N P+ F + ID+ T GF+GV RWG K +P K R+ IG+ Sbjct: 201 LENPAPVRKV-FSPDEMIDVIGVTKGHGFKGVTYRWGTKKLPRK--THKGLRKVACIGA- 256 Query: 264 GEKARVWPGTKMPGHMGNRWRTLRGVKILRI 172 ARV G G RT KI RI Sbjct: 257 WHPARVSFSVARAGQAGYHHRTELNKKIYRI 287 >SB_766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 33.1 bits (72), Expect = 0.23 Identities = 21/76 (27%), Positives = 31/76 (40%) Frame = +1 Query: 172 NTENLNTTQCSPSVTHVSRHFCSRPNSCFFTTRTNITRSSMSFGDSMRSRHTLKTPPLHH 351 N NL T S +T + H +R NS T N+ S G + + H L H Sbjct: 1570 NNNNLLTRDNSHGITSDNSHGITRNNSHGITRDNNVLTRDNSHGITRDNSHVLTRGNSHE 1629 Query: 352 SLKTSIHSFRSNVNTI 399 + + H R+N + I Sbjct: 1630 ITRDNSHGIRNNSHGI 1645 >SB_52575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1267 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 366 RGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKAR 250 RG QG G +G+P SHG+ PG IG GEK + Sbjct: 184 RGIQGRKGNRGVQGIPGSHGI------PGRIGIKGEKGK 216 >SB_16976| Best HMM Match : Collagen (HMM E-Value=4.1e-11) Length = 111 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 366 RGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKAR 250 RG QG G +G+P SHG+ PG IG GEK + Sbjct: 62 RGIQGRKGNRGVQGIPGSHGI------PGRIGIKGEKGK 94 >SB_55803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.5 bits (63), Expect = 2.8 Identities = 22/79 (27%), Positives = 43/79 (54%) Frame = +1 Query: 172 NTENLNTTQCSPSVTHVSRHFCSRPNSCFFTTRTNITRSSMSFGDSMRSRHTLKTPPLHH 351 +T NTT+ + S+ +RH +R NS TT+ N TR + S ++ R ++L H+ Sbjct: 61 STTRHNTTRHN-SLNSTTRHNTTRHNSLHNTTKHNTTRHN-SLHNTTR-HNSLPNTTRHN 117 Query: 352 SLKTSIHSFRSNVNTIPNS 408 + + + + + N++PN+ Sbjct: 118 TTRHNSLNSTTMHNSLPNT 136 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = +1 Query: 187 NTTQCSPSVTHVSRHFCSRPNSCFFTTRTNITRSSMSFGDSMR--SRH-TLKTPPLHHSL 357 NTT+ + S+ +RH +R NS TTR N TR + + +RH +L H+SL Sbjct: 52 NTTRHN-SLNSTTRHNTTRHNSLNSTTRHNTTRHNSLHNTTKHNTTRHNSLHNTTRHNSL 110 Query: 358 KTSIHSFRSNVNTIPNSKM 414 + + N++ ++ M Sbjct: 111 PNTTRHNTTRHNSLNSTTM 129 Score = 28.3 bits (60), Expect = 6.6 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 12/86 (13%) Frame = +1 Query: 187 NTTQCSPSVTHVSRHFCSRPNSCFFTTRTN----ITRSSMSFGDSMRS--RH-TLKTPPL 345 NTT+ + S+ + +RH +R NS TTR N TR + + +S+ S RH T + L Sbjct: 29 NTTRHN-SLHNTTRHNTTRHNSLHNTTRHNSLNSTTRHNTTRHNSLNSTTRHNTTRHNSL 87 Query: 346 HHSLK--TSIHSFRSNV---NTIPNS 408 H++ K T+ H+ N N++PN+ Sbjct: 88 HNTTKHNTTRHNSLHNTTRHNSLPNT 113 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -1 Query: 363 GFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKARVWP 241 G QG ++ G G G + PG GS GE+ RV P Sbjct: 513 GAQGTKRKPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGP 553 >SB_21625| Best HMM Match : VAR1 (HMM E-Value=6.3) Length = 269 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/70 (22%), Positives = 30/70 (42%) Frame = +1 Query: 181 NLNTTQCSPSVTHVSRHFCSRPNSCFFTTRTNITRSSMSFGDSMRSRHTLKTPPLHHSLK 360 N N+ Q ++ H+ +H + N RTNI + +HT P + L Sbjct: 78 NENSLQVRTNIAHIQKH---KYNENSLQVRTNIAHIQYHKYNENSLQHTHTVPQVQRELA 134 Query: 361 TSIHSFRSNV 390 TS + + +++ Sbjct: 135 TSTYPYSTHI 144 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 28.7 bits (61), Expect = 5.0 Identities = 23/59 (38%), Positives = 27/59 (45%), Gaps = 5/59 (8%) Frame = -1 Query: 369 DRGFQGVMKRWGFKGMPASHGVTKTH---RRPGNIGSGGEK-ARVWPG-TKMPGHMGNR 208 +RG QG G G P S G T +PG GS GEK + PG +PG G R Sbjct: 3702 ERGAQGPRGEKGNTGAPGSQGSTGPRGPIGQPGMAGSQGEKGGKGDPGFPGLPGQAGLR 3760 >SB_2570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -1 Query: 357 QGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKARVWPGTK-MPGHMGNR 208 QG + G G+P HG T + GN G G+ PG K PG G+R Sbjct: 31 QGHDGKNGIPGIPGVHGKPGTPGKSGNDGRNGKPGA--PGPKGPPGPKGSR 79 >SB_6496| Best HMM Match : Collagen (HMM E-Value=0) Length = 1234 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -1 Query: 375 TMDRGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKARVWPGTK-MPGHMGNR 208 T DRG G++ G KGM G PG G G++ PG+ +PG G+R Sbjct: 196 TGDRGKPGLVGDPGKKGMAGRAGAMGMRGLPGPPGRRGKRGD--PGSDGIPGERGDR 250 >SB_35384| Best HMM Match : PRA1 (HMM E-Value=6.7) Length = 654 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = -1 Query: 603 VKWVEKQKYGCILVGAENIDPSVVTKDYCGIFDSVGMLPKRHLCRFVVSPESALPN 436 + + KQ+ +L+G + +V+TK YC +D P+ H+ + + + PN Sbjct: 164 INCIAKQEKAVLLIGEQGTAKTVMTKGYCERYD-----PELHVFKAMNFSSATTPN 214 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 327 GMPASHGVTK--THRRPGNIGSGGEKARVWPGTKMPGHMGNRW 205 G+ ++HG + TH + GN+G G + + T+ P N W Sbjct: 209 GLGSTHGTPRKETHDQSGNVGGGITQEPCFTKTEPPAPPSNYW 251 >SB_15668| Best HMM Match : Chorion_3 (HMM E-Value=2.5) Length = 276 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -1 Query: 327 GMPASHGVTK--THRRPGNIGSGGEKARVWPGTKMPGHMGNRW 205 G+ ++HG + TH + GN+G G + + T+ P N W Sbjct: 143 GLGSTHGTPRKETHDQSGNVGGGITQEPCFTKTEPPAPPSNYW 185 >SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/30 (56%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 133 CNT-QCPNNIIFCINTENLNTTQCSP-SVT 216 CNT QC N C NT NTTQC+ SVT Sbjct: 282 CNTTQC--NTTQCCNTTQCNTTQCNKHSVT 309 >SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/25 (52%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +1 Query: 181 NLNTTQCSPS-VTHVSRHFCSRPNS 252 +L+ +QC+ S VT VSR C+RPN+ Sbjct: 308 SLDLSQCASSHVTTVSRVLCARPNT 332 >SB_36009| Best HMM Match : Collagen (HMM E-Value=0) Length = 687 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/61 (32%), Positives = 23/61 (37%) Frame = -1 Query: 441 PNGTPLYATHFRVGDCIDIRSKTMDRGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGG 262 P G P RVG + K DRG G G G P G PG++G G Sbjct: 105 PPGPPGKPVIRRVG-IPGLPGKRGDRGTPGAKGPPGLAGEPGEPGTQGPRGDPGDVGEPG 163 Query: 261 E 259 E Sbjct: 164 E 164 >SB_2182| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 299 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 145 CPNNIIFCINTENLNTTQCSPSVTHVSRHFCSRPNSC 255 CP N +C+N + T +C P T V+ + C N C Sbjct: 166 CPANR-YCVNNDGSYTCKCKPGYTLVN-NTCEDINEC 200 >SB_29801| Best HMM Match : Collagen (HMM E-Value=3.2e-12) Length = 182 Score = 27.9 bits (59), Expect = 8.7 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 2/81 (2%) Frame = -1 Query: 369 DRGFQGVMKRWGFKGMPASHGVTKTHRRPGNIGSGGEKARVWP-GTK-MPGHMGNRWRTL 196 +RG +G G G P + G PG G GEK P G K PG + + R + Sbjct: 39 NRGRRGRRGPRGPPGKPGADGKPGIRGPPGPKGDKGEKGDAGPRGLKGDPGKIRDAPRVI 98 Query: 195 RGVKILRIDTKYNVIWTLGVA 133 + L ID+ V+ V+ Sbjct: 99 IAPQKLNIDSSATVVLNCSVS 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,763,937 Number of Sequences: 59808 Number of extensions: 549280 Number of successful extensions: 2166 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2159 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -