BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c10r (684 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48638-8|CAA88568.1| 237|Caenorhabditis elegans Hypothetical pr... 31 0.77 AF025465-4|AAB71029.1| 297|Caenorhabditis elegans Hypothetical ... 28 5.4 >Z48638-8|CAA88568.1| 237|Caenorhabditis elegans Hypothetical protein ZK892.6 protein. Length = 237 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -1 Query: 219 CVRFFISMRYTL*LLATESIGPHTSLQHTSL*L*AQLYNNIEVYILRMKLCDFYL 55 C+ F T LLAT+ +GP + ++ TS L +N++ V + + + +F L Sbjct: 112 CLFFVDGKDVTFCLLATDKVGPWSDIEETSAPLRFDYHNHLRVCVRKDTIQEFQL 166 >AF025465-4|AAB71029.1| 297|Caenorhabditis elegans Hypothetical protein K02E7.9 protein. Length = 297 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 465 PISAGFGLNGGAAVVTILKYYNSY 394 PI + F GG ++T+ KY N+Y Sbjct: 77 PIDSNFDKRGGICIMTVPKYINAY 100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,358,428 Number of Sequences: 27780 Number of extensions: 293276 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -