Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11c10r
         (684 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g64930.1 68414.m07360 cytochrome P450, putative similar to cy...    29   3.8  

>At1g64930.1 68414.m07360 cytochrome P450, putative similar to
           cytochrome P450 CYP89 (SP:Q42602)[Arabidopsis thaliana];
           similar to cytochrome p450 GI:438242 from [Solanum
           melongena]
          Length = 511

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = -3

Query: 547 ALRL*GLFFTGSRTSCESARV-GTNHHTAYFCRFRFEWRGSRCNYTEIL*LISQGGWRHL 371
           AL L G  F     +   +++   N HT   C +   WR  R N TEIL       + H+
Sbjct: 91  ALVLNGAVFADRPPAAPISKILSNNQHTITSCLYGVTWRLLRRNITEILHPSRMKSYSHV 150

Query: 370 R 368
           R
Sbjct: 151 R 151


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,304,311
Number of Sequences: 28952
Number of extensions: 264470
Number of successful extensions: 485
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 485
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)