BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c09r (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0448 + 29462920-29463052,29463220-29463349,29463608-294637... 30 1.4 03_02_0721 - 10677286-10678018,10679293-10679373,10682516-106826... 28 5.5 03_01_0311 + 2453057-2454610 28 5.5 07_03_0483 - 18605176-18606118,18606353-18606482,18606609-18606738 27 9.6 >01_06_0448 + 29462920-29463052,29463220-29463349,29463608-29463732, 29463923-29464458 Length = 307 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 474 RGTQLGKHHPTLPGSESPNFWNETISASVLN 566 R Q+ KH P +E NFWN TI +++ Sbjct: 88 RWAQIAKHLPGRTDNEVKNFWNSTIKKKLIS 118 >03_02_0721 - 10677286-10678018,10679293-10679373,10682516-10682645, 10682969-10683101 Length = 358 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 450 CFHGKSRLRGTQLGKHHPTLPGSESPNFWNETISASV 560 CF + +R + + H P +E N+WN +S + Sbjct: 107 CFQQNTHVRWSLIASHLPGRTDNEIKNYWNSHLSRQI 143 >03_01_0311 + 2453057-2454610 Length = 517 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 620 RHSCVPKCRNSTIXRLIQIKNGS*NCFIP 534 RH + +C S++ LIQ + G C IP Sbjct: 330 RHHLIRQCGASSLCNLIQCRKGEKKCLIP 358 >07_03_0483 - 18605176-18606118,18606353-18606482,18606609-18606738 Length = 400 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 474 RGTQLGKHHPTLPGSESPNFWNETISASVL 563 R Q+ KH P +E NFWN I ++ Sbjct: 87 RWAQIAKHLPGRTDNEVKNFWNSCIKKKLI 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,236,453 Number of Sequences: 37544 Number of extensions: 255938 Number of successful extensions: 651 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 651 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -