BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c09r (642 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) 27 9.8 >SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2047 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -1 Query: 603 KVSQLHYXTSHPD*ERKLKLFHS--KNWATQNQVALGDAYQAVFRGAE 466 KV ++ S ++KLKLFHS W T N G Y + +G E Sbjct: 743 KVKKMSMFLSFSGADQKLKLFHSTLSEWLTSNITFGGPFYVSKTKGHE 790 >SB_16935| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2204 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -1 Query: 405 VTGDTVYEASTAANVIXXXXXXXXXPNLVEPATPSLPVPDA--APVSTFLS 259 VTG+T YEA T+ +V+ L A ++ + DA AP FLS Sbjct: 646 VTGNTNYEALTSDHVVSVGIFCRDKGGLSAQADYNISILDANDAPTQVFLS 696 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,570,190 Number of Sequences: 59808 Number of extensions: 307552 Number of successful extensions: 837 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -