BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06r (724 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2RLE1 Cluster: Transcriptional regulator, IclR family;... 34 4.1 UniRef50_A2DYQ3 Cluster: Putative uncharacterized protein; n=1; ... 33 5.4 UniRef50_Q556E5 Cluster: Putative uncharacterized protein; n=2; ... 33 9.4 >UniRef50_Q2RLE1 Cluster: Transcriptional regulator, IclR family; n=2; Thermoanaerobacteriaceae|Rep: Transcriptional regulator, IclR family - Moorella thermoacetica (strain ATCC 39073) Length = 268 Score = 33.9 bits (74), Expect = 4.1 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +1 Query: 301 VG*SKTIANINRQKKLHLRIVSRIKYAIGKCEQHAILSKKVIGIKLLTNSGSLL 462 +G S+ +N K R++S +K A G +Q K V+G+K+L SGSLL Sbjct: 28 IGLSELSRRLNLNKSTVYRMLSTLK-AYGYVDQEETTEKYVLGLKILDLSGSLL 80 >UniRef50_A2DYQ3 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 474 Score = 33.5 bits (73), Expect = 5.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 161 RKICMHYMRSILNCV*LHYFYSNIKKDHCQQKSLKC 268 + C+ YM+ N + + YF + K +HCQ K KC Sbjct: 411 KDFCIDYMKDFANHLNVSYFPVHKKPEHCQCKDFKC 446 >UniRef50_Q556E5 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 555 Score = 32.7 bits (71), Expect = 9.4 Identities = 17/69 (24%), Positives = 31/69 (44%) Frame = -3 Query: 512 IRPFTLIILKFHINVWIKREPELVSNLMPITFFDNIACCSHLPIAYFILETIRRCSFFCL 333 I PFT++ +I W+K +L+ +FF + + +F+ I F + Sbjct: 186 ILPFTIVFSLLYIWAWLKLAANHAESLIKYSFFGAMGLMIGYCVFFFVWGAIYLGIIFAI 245 Query: 332 LMFAIVLDY 306 + F I+L Y Sbjct: 246 MAFFIILFY 254 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,024,288 Number of Sequences: 1657284 Number of extensions: 11862632 Number of successful extensions: 22833 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22792 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 58677691418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -