BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06r (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 24 4.1 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 4.1 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 404 ACCSHLPIAYFILETIRRCSFFCLLMFAIVLDY 306 A LP+ + I +FC ++F +VL Y Sbjct: 67 AMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGY 99 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 416 FDNIACCSHLPIAYF 372 F I CCSHL +A F Sbjct: 125 FSKIYCCSHLCLAIF 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,343 Number of Sequences: 2352 Number of extensions: 15022 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -