BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06f (566 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17421| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_17421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = -1 Query: 257 RTQSCNHRLIKIKFYMCILATY--FHVSARVQSFQNCIVFI*FHSRLTY 117 + Q+ H L ++ FY+ + T+ FH+S+R SF I HS L Y Sbjct: 440 KKQNTTHSLSRV-FYVLYIVTHTSFHISSRTHSFTYRHARIVSHSELNY 487 >SB_55747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 5 TQIETSLTTRLTKHLSQFINIVYIPYPINESTK 103 TQ++T +T + K ++ +IN ++ IN+ TK Sbjct: 145 TQLDTDITNDIQKRVTTYINRMHTDGIINQDTK 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,103,695 Number of Sequences: 59808 Number of extensions: 311444 Number of successful extensions: 527 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -