BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06f (566 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 27 0.43 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 9.2 AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A prot... 23 9.2 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 9.2 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 27.1 bits (57), Expect = 0.43 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -3 Query: 216 LYVYISNIFSRFGQGTKLSKLYSLHLVPFSFDVHCPIIFVDSFIGYG 76 L +++NIF F GT+L +Y+ F H ++ S +G+G Sbjct: 592 LMSFVTNIFRSFEAGTQLDAIYTDFHAAFDSLPHSLLLAKLSKLGFG 638 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 22.6 bits (46), Expect = 9.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 171 YPGRNVKICC*YTHIKFDFNQTMITTLSANAHL*KAAAT 287 + GRN+ T KFD ++ ++ NA KAA+T Sbjct: 219 HSGRNIANWIQGTLNKFDIEDKIVAMVTDNASNMKAAST 257 >AY344825-1|AAR02436.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 371 DRRFSPLIVAHKVTCIYFNNCNIG 300 D + P+++AH C F CN G Sbjct: 26 DPKQPPVLLAHSTDCDKFLICNHG 49 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 22.6 bits (46), Expect = 9.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 470 SILGSSHKATARHYLA 423 +I+G HK+TA YLA Sbjct: 549 TIIGFIHKSTAEKYLA 564 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 558,120 Number of Sequences: 2352 Number of extensions: 10922 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -