BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06f (566 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002906-1|AAH02906.2| 261|Homo sapiens uridine-cytidine kinase... 31 3.7 AL451074-10|CAH74066.1| 261|Homo sapiens uridine-cytidine kinas... 31 3.7 AL358115-1|CAI15121.1| 261|Homo sapiens uridine-cytidine kinase... 31 3.7 AF236637-1|AAK14053.1| 261|Homo sapiens uridine-cytidine kinase... 31 3.7 AB062451-1|BAB56162.1| 247|Homo sapiens uridine-cytidine kinase... 31 3.7 >BC002906-1|AAH02906.2| 261|Homo sapiens uridine-cytidine kinase 2 protein. Length = 261 Score = 30.7 bits (66), Expect = 3.7 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 285 TLFQATNIAIIKVNACDFVSHNKWREATVTYKCAARLLIESVIKHYS 425 TL + T +++ DFVSH++ +E TVT A +L E ++ YS Sbjct: 97 TLKEITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYS 142 >AL451074-10|CAH74066.1| 261|Homo sapiens uridine-cytidine kinase 2 protein. Length = 261 Score = 30.7 bits (66), Expect = 3.7 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 285 TLFQATNIAIIKVNACDFVSHNKWREATVTYKCAARLLIESVIKHYS 425 TL + T +++ DFVSH++ +E TVT A +L E ++ YS Sbjct: 97 TLKEITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYS 142 >AL358115-1|CAI15121.1| 261|Homo sapiens uridine-cytidine kinase 2 protein. Length = 261 Score = 30.7 bits (66), Expect = 3.7 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 285 TLFQATNIAIIKVNACDFVSHNKWREATVTYKCAARLLIESVIKHYS 425 TL + T +++ DFVSH++ +E TVT A +L E ++ YS Sbjct: 97 TLKEITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYS 142 >AF236637-1|AAK14053.1| 261|Homo sapiens uridine-cytidine kinase 2 protein. Length = 261 Score = 30.7 bits (66), Expect = 3.7 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 285 TLFQATNIAIIKVNACDFVSHNKWREATVTYKCAARLLIESVIKHYS 425 TL + T +++ DFVSH++ +E TVT A +L E ++ YS Sbjct: 97 TLKEITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYS 142 >AB062451-1|BAB56162.1| 247|Homo sapiens uridine-cytidine kinase 2 protein. Length = 247 Score = 30.7 bits (66), Expect = 3.7 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +3 Query: 285 TLFQATNIAIIKVNACDFVSHNKWREATVTYKCAARLLIESVIKHYS 425 TL + T +++ DFVSH++ +E TVT A +L E ++ YS Sbjct: 83 TLKEITEGKTVQIPVYDFVSHSR-KEETVTVYPADVVLFEGILAFYS 128 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,940,600 Number of Sequences: 237096 Number of extensions: 1456142 Number of successful extensions: 1926 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1875 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1926 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5759818212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -