BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c06f (566 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 3.7 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 6.5 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 8.6 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 8.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 59 INIVYIPYPINESTKIIGQCTSNENGTK*RLYNFESFV 172 I++ Y P+ G T N + LYN ++FV Sbjct: 153 IDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFV 190 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 129 SFDVHCPIIFVDSFIGY 79 S++VH P+ D++IG+ Sbjct: 52 SWEVHDPVTNSDTYIGF 68 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 259 THICEKQPRRCSKRPIL 309 +H+C PR SK P+L Sbjct: 44 SHLCLPAPRINSKSPLL 60 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 259 THICEKQPRRCSKRPIL 309 +H+C PR SK P+L Sbjct: 44 SHLCLPAPRINSKSPLL 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,353 Number of Sequences: 438 Number of extensions: 3174 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -