BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c05r (759 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U61947-6|AAB03138.1| 137|Caenorhabditis elegans Hypothetical pr... 28 8.3 U23168-5|ABD63247.1| 2702|Caenorhabditis elegans Temporarily ass... 28 8.3 U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily ass... 28 8.3 >U61947-6|AAB03138.1| 137|Caenorhabditis elegans Hypothetical protein C06G3.8 protein. Length = 137 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 116 INLLIIDAQFSNTYKKGQFYKNNVQIKLLYYGSLNYVSWRSNEM*RVRIHILMF 277 IN I++ +F+ T+K G K +Y G L +S E +V +++F Sbjct: 49 INASIMNPEFNETFKPGDILKFRGAYTSIYQGGLTLSVGKSGECKKVGEFMMVF 102 >U23168-5|ABD63247.1| 2702|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform e protein. Length = 2702 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 730 RLCKKDLAIKRNKNKNKGLKIVRQLQEANKYR 635 RL +K+ K +N NKG+ + +++ EA +YR Sbjct: 1374 RLGEKEAIKKVLQNSNKGINVEKKMIEATEYR 1405 >U23168-1|AAU87832.1| 7548|Caenorhabditis elegans Temporarily assigned gene nameprotein 308, isoform c protein. Length = 7548 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 730 RLCKKDLAIKRNKNKNKGLKIVRQLQEANKYR 635 RL +K+ K +N NKG+ + +++ EA +YR Sbjct: 6220 RLGEKEAIKKVLQNSNKGINVEKKMIEATEYR 6251 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,257,349 Number of Sequences: 27780 Number of extensions: 331495 Number of successful extensions: 762 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -