BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c05f (573 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 2.3 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 7.1 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.6 bits (51), Expect = 2.3 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +2 Query: 161 NKSL*FFVKMEI-IHKSLQEQTLRSTIEDLPDEVLEFILSFLPPYR 295 N L F+ ++ I KSL++ L+STI + V EF+ LP R Sbjct: 294 NLDLMSFISFKVSIPKSLKDLALQSTIWPVSLTVREFVDRGLPKQR 339 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = +2 Query: 359 KTSIKLVKAIGEFKILWKNLSPTNMFPVITKRFSHAACILENSMYIF 499 KTS++L+ + ++ L P + K F+H + + IF Sbjct: 817 KTSLRLITTTTDHQLSEVELRPNLPANFVVKAFAHGYATYDGRLEIF 863 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,297 Number of Sequences: 2352 Number of extensions: 15586 Number of successful extensions: 26 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -