BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11c01r (757 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q54ZY7 Cluster: Putative uncharacterized protein; n=2; ... 34 4.4 >UniRef50_Q54ZY7 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 667 Score = 33.9 bits (74), Expect = 4.4 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Frame = +1 Query: 25 K*RPKTFVYILIDQYYTQYILKYSKVYKMKRIVLIRK*A*KDLFKFSSV-----YLESNI 189 K +P T+ Y + Y +YI Y+ +YK I L+R+ KD+ KF+ + Y E NI Sbjct: 543 KIKPVTYYYYMALSY--EYIDPYNNIYKHDYIDLLRRNPPKDIRKFNKLLLSQDYREGNI 600 Query: 190 AH 195 H Sbjct: 601 QH 602 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,842,053 Number of Sequences: 1657284 Number of extensions: 10654514 Number of successful extensions: 17819 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 17277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17817 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -