Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11c01r
         (757 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    22   4.6  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    22   6.1  

>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 113 FILYTLEYFSMY 78
           F LY +EYF MY
Sbjct: 427 FKLYAVEYFQMY 438


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 4/32 (12%)
 Frame = +3

Query: 447 CCYFLLFSFSKN----K*TYLVNNTSNLWH*F 530
           CC  L+FS++ N    +  YL  N  N ++ F
Sbjct: 8   CCLLLMFSYTDNVSSTRTKYLRTNFPNFYNDF 39


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,903
Number of Sequences: 336
Number of extensions: 3365
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20234955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)