BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b20r (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-53... 28 6.0 >05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-536903, 537755-537762,538146-538183,538475-538668,539168-539296, 539392-539481,539726-539839,540008-540154,540228-540293, 540876-540987 Length = 462 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -2 Query: 662 VVGIICPIFAPKGPNRGIIQVVLILTAATCWLFWLCAYMAQMN 534 V+G+ C + P G I + L +T +T ++W AY+ +++ Sbjct: 385 VLGLACGLLWGAVPLVGAIWIALFVTISTGLVYWYYAYLLKID 427 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,797,420 Number of Sequences: 37544 Number of extensions: 317416 Number of successful extensions: 487 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -