BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b20r (678 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 26 1.3 AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B pro... 24 5.1 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 6.7 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 8.9 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 8.9 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 338 PKT*CNILLCRILVYLYSSKMNKVEYSMMHR 246 P+T N R L YL K K+EYS+ H+ Sbjct: 240 PETASNNECARFLYYLGRIKAAKLEYSVAHK 270 >AY752908-1|AAV30082.1| 103|Anopheles gambiae peroxidase 13B protein. Length = 103 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 415 KPLQGLLRSDD*ACVLFILFPQVRE 489 +PLQG L AC++ I F Q+R+ Sbjct: 74 RPLQGGLVGPTFACIIAIQFRQLRK 98 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 103 SQTRINYGAIKDARFVNLRREKKIILQ 183 S TR YG++ R V+++R+ +++LQ Sbjct: 326 SLTRAAYGSLWYRRSVSIQRKLRMVLQ 352 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 39 ND*VPNDSTVFNCILFFFFLSIAN 110 +D VP T FNCI+F S+ + Sbjct: 271 SDAVPLLGTYFNCIMFMVASSVVS 294 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 8.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 39 ND*VPNDSTVFNCILFFFFLSIAN 110 +D VP T FNCI+F S+ + Sbjct: 303 SDAVPLLGTYFNCIMFMVASSVVS 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 704,556 Number of Sequences: 2352 Number of extensions: 12958 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -