BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b20f (623 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0830 + 25159758-25162460 29 4.0 05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-53... 28 5.2 01_01_0318 - 2572049-2572179,2572280-2572405,2572958-2573201 28 5.2 >06_03_0830 + 25159758-25162460 Length = 900 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -1 Query: 191 NPSVWSFRCEDGANNTNHTPKDGENEDRDKGVAHFEM 81 NPSV S C +G N T + N D G A + Sbjct: 235 NPSVPSLACRNGLENVPVTEESSANNDAKSGAAQVSL 271 >05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-536903, 537755-537762,538146-538183,538475-538668,539168-539296, 539392-539481,539726-539839,540008-540154,540228-540293, 540876-540987 Length = 462 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +3 Query: 138 VVGIICPIFAPKGPNRGIIQVVLILTAATCWLFWLCAYMAQMN 266 V+G+ C + P G I + L +T +T ++W AY+ +++ Sbjct: 385 VLGLACGLLWGAVPLVGAIWIALFVTISTGLVYWYYAYLLKID 427 >01_01_0318 - 2572049-2572179,2572280-2572405,2572958-2573201 Length = 166 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 139 TPQRMEKTKIGIRE*PILRCYL-DISSNFDYLKQTSAAPRW 20 TPQ+++ +K+GI+ + YL D++ + L Q + RW Sbjct: 106 TPQKVQTSKVGIKNKKVQAQYLSDLAKEAERLSQENENLRW 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,238,835 Number of Sequences: 37544 Number of extensions: 319672 Number of successful extensions: 558 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 558 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -