BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b18f (547 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 25 0.57 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.00 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.00 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.00 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 1.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 4.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 4.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 4.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 4.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 5.3 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 5.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.3 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.3 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.3 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 24.6 bits (51), Expect = 0.57 Identities = 16/56 (28%), Positives = 24/56 (42%) Frame = -2 Query: 438 WEHSDLLYSNRSEAILFSHEPQRHLCPGTRRARLYCWSIWKRPRRLHQRLQQWSWL 271 W D+ S A +F + + AR+ ++WK+ R H RL Q S L Sbjct: 102 WTFIDVFIMLTSTAFVFRLKQLNAKVEMLKNARVKNTALWKQLRYEHYRLYQLSVL 157 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.00 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S SVH+W +L Sbjct: 219 WIWLVWLLSQAWISVHIWSPNCDKL 243 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.00 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S SVH+W +L Sbjct: 452 WIWLVWLLSQAWISVHIWSPNCDKL 476 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.00 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S SVH+W +L Sbjct: 452 WIWLVWLLSQAWISVHIWSPNCDKL 476 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.4 bits (48), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 226 GS*PRTVKPFLTKFAAMNPPMFPRPRKATFLSV 128 G P T FL A M PP P P TF S+ Sbjct: 158 GRAPLTYHQFLAIIACMGPPPQPEP-PVTFNSL 189 Score = 21.8 bits (44), Expect = 4.0 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 329 GQYGNDHVDSINGCSNGVGWRHSVLGRCVQCIFGR 225 GQ G +D+I GW H + V C R Sbjct: 346 GQTGFPWIDAIMTQLREEGWIHHLARHAVACFLTR 380 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S ++H+W + L Sbjct: 465 WIWLLWLLSQTWITLHIWTPKCERL 489 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S ++H+W + L Sbjct: 465 WIWLLWLLSQTWITLHIWTPKCERL 489 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S ++H+W + L Sbjct: 465 WIWLLWLLSQTWITLHIWTPKCERL 489 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -2 Query: 282 WSWLASLRSWPLRSVHLWKDRSREL 208 W WL L S ++H+W + L Sbjct: 465 WIWLLWLLSQTWITLHIWTPKCERL 489 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 172 PPMFPRPRKATFLSVLELYARLAAVYK 92 PP P PR +F + +++ +YK Sbjct: 731 PPPPPPPRVESFAETVRTVSKIPPLYK 757 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.4 bits (43), Expect = 5.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 490 GASVNPSPFSRAIGKICLGTFGSIVLESIRSDPFF 386 G S+N S + LG FG VL + FF Sbjct: 114 GYSINYRRISIFVNLAILGVFGEFVLVFVPDYVFF 148 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 9.3 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = -3 Query: 524 SVLSTHDSSRYRCICESQ 471 + + T+D YRC+ S+ Sbjct: 479 TAIHTNDGGLYRCVASSK 496 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 20.6 bits (41), Expect = 9.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 103 PPDGRIVLTPTRMWLSSASETWEGSWLRTWL 195 P D +VLT T+ S + SWL T L Sbjct: 85 PEDVELVLTDTKQNTKSFIYHFLHSWLGTGL 115 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 20.6 bits (41), Expect = 9.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 103 PPDGRIVLTPTRMWLSSASETWEGSWLRTWL 195 P D +VLT T+ S + SWL T L Sbjct: 85 PEDVELVLTDTKQNTKSFIYHFLHSWLGTGL 115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,211 Number of Sequences: 336 Number of extensions: 3320 Number of successful extensions: 15 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -