BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b12r (570 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces p... 25 5.9 SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|... 25 7.8 >SPAC926.07c |dlc2||dynein light chain Dlc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 85 Score = 25.4 bits (53), Expect = 5.9 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 301 DRHIXQFIKRRHDCAFKPLRRCF---NF-I*VGHVVKTFSWFYL 420 ++ I FIKR D F P C NF V H + F +FYL Sbjct: 31 EKDIAAFIKREFDKKFSPTWHCIVGRNFGSFVTHESRHFIYFYL 74 >SPAC3H1.02c |||metallopeptidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.0 bits (52), Expect = 7.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 372 VEAAPQWLKGTIMAPFDEL 316 +EAAP L GTI P+ E+ Sbjct: 590 IEAAPALLSGTIPTPYHEV 608 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,299,178 Number of Sequences: 5004 Number of extensions: 45120 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -