BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b11f (552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 1.3 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 1.3 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 23 1.3 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 23.4 bits (48), Expect = 1.3 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 4/76 (5%) Frame = -1 Query: 396 GVDGSNDDGLRD----NGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGN 229 G DG + D + NG L F D+ G ++G HDE+ T GN Sbjct: 68 GDDGDDKDSITSDGGKNGKLSDKFLDDEMSKKSCQGCEMPSAGLCGSHDEIPDISSTRGN 127 Query: 228 SRSNDNRSGLHGSSHY 181 +N+ S + ++++ Sbjct: 128 --NNNTPSATNNNTNF 141 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 23.4 bits (48), Expect = 1.3 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 4/76 (5%) Frame = -1 Query: 396 GVDGSNDDGLRD----NGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGN 229 G DG + D + NG L F D+ G ++G HDE+ T GN Sbjct: 16 GDDGDDKDSITSDGGKNGKLSDKFLDDEMSKKSCQGCEMPSAGLCGSHDEIPDISSTRGN 75 Query: 228 SRSNDNRSGLHGSSHY 181 +N+ S + ++++ Sbjct: 76 --NNNTPSATNNNTNF 89 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 23.4 bits (48), Expect = 1.3 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 4/76 (5%) Frame = -1 Query: 396 GVDGSNDDGLRD----NGALFSLFDDNNGLGLDFSGSNRNTSGDVDVHDELHKRRGTGGN 229 G DG + D + NG L F D+ G ++G HDE+ T GN Sbjct: 199 GDDGDDKDSITSDGGKNGKLSDKFLDDEMSKKSCQGCEMPSAGLCGSHDEIPDISSTRGN 258 Query: 228 SRSNDNRSGLHGSSHY 181 +N+ S + ++++ Sbjct: 259 --NNNTPSATNNNTNF 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,870 Number of Sequences: 336 Number of extensions: 966 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -