BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b10r (701 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding ... 29 2.3 At3g49970.1 68416.m05464 phototropic-responsive protein, putativ... 29 2.3 >At5g49840.1 68418.m06172 ATP-dependent Clp protease ATP-binding subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus splice donor GC at exon 4; non-consensus splice donor AA at exon 7 Length = 606 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 126 FCTLVICRKISNKLYTRYNMILRLHTFLSNMDNP 227 FC+L I R +S K T +++ R FL ++D+P Sbjct: 2 FCSLSISRFVSRKTITSSSLLSRSFRFLLSVDSP 35 >At3g49970.1 68416.m05464 phototropic-responsive protein, putative similar to root phototropism RPT2 [Arabidopsis thaliana] gi|6959488|gb|AAF33112, a signal transducer of phototropic response PMID:10662859 Length = 526 Score = 29.5 bits (63), Expect = 2.3 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 Query: 129 CTLVICRKISNKLYTRYNMILRLHTFLSNMDNPLFFLSVATLKSP 263 C+L+ C+K+S +Y R LSN D+P + TL P Sbjct: 383 CSLMDCKKLSRDVYAHAAQNDRFQENLSNSDSPAPATAEKTLSPP 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,038,250 Number of Sequences: 28952 Number of extensions: 232343 Number of successful extensions: 407 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -