BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b10f (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 27 0.48 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.83 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 25 2.5 U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles ... 24 4.4 EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426174-1|ABO26417.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426169-1|ABO26412.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426167-1|ABO26410.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426166-1|ABO26409.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426165-1|ABO26408.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426164-1|ABO26407.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426162-1|ABO26405.1| 155|Anopheles gambiae unknown protein. 24 4.4 EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. 24 4.4 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 24 4.4 EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. 23 5.9 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 5.9 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 5.9 EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 23 7.8 EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 23 7.8 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 7.8 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 7.8 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 27.1 bits (57), Expect = 0.48 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = +1 Query: 403 GNRFYGPGGPYAVFGGRDATRGLATFSVTAPEKDYDDLS------DLNSMEMESVREWEE 564 GNR GP P + G + + S+ PEK + L DL + + E++ EE Sbjct: 832 GNR--GPSSPSSTSGAASPIQTVKNDSLEEPEKQINYLPDWLYDVDLKNGDTETISASEE 889 Query: 565 QFRENYDLVGRLLRP 609 QF +L+ + L+P Sbjct: 890 QFW--IELIEKYLKP 902 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.83 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 497 SGAVTENVASPLVASLPPKTAYGPPGP 417 +G V E SP V +PP++ PP P Sbjct: 1094 TGEVEEEEVSPPVPPIPPRSRRLPPSP 1120 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +1 Query: 283 KKLPKLRKDMTAVELRQYDGTQEGGRVLMAVNGWIFDVTRG 405 ++ KL KD+ EL+ D + + +N W+ + T G Sbjct: 57 ERYDKLAKDLYKSELKPLDFVGDETGSVRYINSWVHNQTHG 97 >U50474-1|AAA93476.1| 62|Anopheles gambiae protein ( Anopheles gambiae putativetrypsin-like enzyme precursor, mRNA, partial cds. ). Length = 62 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +2 Query: 98 PRIKWIHHQRLKMCK-PNTVAFLRP 169 P ++WIH R+++ P T A RP Sbjct: 37 PPVRWIHRYRVRISDVPPTPALPRP 61 >EF426178-1|ABO26421.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426177-1|ABO26420.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426174-1|ABO26417.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426173-1|ABO26416.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426172-1|ABO26415.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426171-1|ABO26414.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426170-1|ABO26413.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426169-1|ABO26412.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426168-1|ABO26411.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426167-1|ABO26410.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426166-1|ABO26409.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426165-1|ABO26408.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426164-1|ABO26407.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426163-1|ABO26406.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426162-1|ABO26405.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >EF426161-1|ABO26404.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 425 VGHMLFLEEEMPQEDSPRSLSQHLKRTM 508 +GH LFL E Q+ P +S + K T+ Sbjct: 59 MGHSLFLPAESRQQLEPACVSVYAKGTV 86 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 413 STVPVGHMLFLEEEM 457 ST PV H+L LEEE+ Sbjct: 177 STEPVEHVLHLEEEL 191 >EF426175-1|ABO26418.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.4 bits (48), Expect = 5.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 428 GHMLFLEEEMPQEDSPRSLSQHLKRTM 508 GH LFL E Q+ P +S + K T+ Sbjct: 60 GHSLFLPAESRQQLEPACVSVYAKGTV 86 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 5.9 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 250 YKTHCSKVAPLKKLPKLRKDMTAVELRQYDGTQ 348 + H + PL+ LPK ++L YD Q Sbjct: 846 FTIHLTADVPLQNLPKAHTCFNRLDLPMYDSYQ 878 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 346 QEGGRVLMAVNG-WIFDVTRGNRFYG 420 +EG RVL+AVNG W + YG Sbjct: 91 EEGDRVLIAVNGIWAERAVEMSERYG 116 >EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 23.0 bits (47), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 475 WRVLLWHLFLQKQHM 431 W +LWHLF + +H+ Sbjct: 26 WWWVLWHLFHEYEHI 40 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 393 CD*RESVLRSRWAICCFWRKRCHKRTR 473 C +++ +R C W K+C +RT+ Sbjct: 72 CFCKKNYVRRAIGGSCIWAKKCPRRTQ 98 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +2 Query: 416 TVPVGHMLFLEEEM 457 +VPV H+L LEEE+ Sbjct: 159 SVPVEHVLHLEEEL 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,849 Number of Sequences: 2352 Number of extensions: 13653 Number of successful extensions: 95 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 95 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -