BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b07r (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 28 0.086 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 4.3 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 5.7 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 27.9 bits (59), Expect = 0.086 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -1 Query: 545 PPLYGARLVQEILTNAELKKQWLGDVKQMADRIITMRSQLRAGIEGAG 402 PP+ +LVQ NAE+K+ + +R+ +++QL A + G Sbjct: 45 PPIANCKLVQAPKLNAEVKRAITQQHSERDERLAHVQAQLGAAMGAVG 92 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 321 TLDLLGLESGEAEHADLVGDVLPGVRV 401 T+ + ++GE+E + V+PGV V Sbjct: 55 TVTITATQTGESEMMVVTSGVIPGVAV 81 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +3 Query: 429 LAPHRDDPVRHLLYVSEPLLFEFGVGEY 512 L P+ P R + Y S ++ G+G Y Sbjct: 14 LQPYDATPARIVCYFSNWAIYRPGIGRY 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,340 Number of Sequences: 336 Number of extensions: 2916 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -