BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b07r (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 2.2 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 2.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.0 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.2 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 Query: 381 HHRPDRHVLLHRTQAR 334 HH ++H +HRTQ + Sbjct: 1680 HHNVNKHCTIHRTQVK 1695 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.2 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 379 MCCQGCGLPAPSMPARSWLRIVMIRSAICFTSPSHCFLSSALVSISCTRRAPYSGGLE 552 M Q G+ A S+P S+ + + I + +C T L ALV+ + +R +S +E Sbjct: 284 MATQTSGINA-SLPPVSYTKAIDIWTGVCLTFVFGALLEFALVNYA-SRSDMHSDNIE 339 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.4 bits (48), Expect = 2.2 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +1 Query: 379 MCCQGCGLPAPSMPARSWLRIVMIRSAICFTSPSHCFLSSALVSISCTRRAPYSGGLE 552 M Q G+ A S+P S+ + + I + +C T L ALV+ + +R +S +E Sbjct: 284 MATQTSGINA-SLPPVSYTKAIDIWTGVCLTFVFGALLEFALVNYA-SRSDMHSDNIE 339 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 358 NMPIWSVMCCQGCGLPAPSMPARS 429 N P SV+ G +P S+PA S Sbjct: 840 NTPTTSVISMSGTTVPITSLPASS 863 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,952 Number of Sequences: 438 Number of extensions: 3419 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -