BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b07f (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57277| Best HMM Match : Phage_T7_Capsid (HMM E-Value=6.7) 101 4e-22 SB_8675| Best HMM Match : Aminotran_1_2 (HMM E-Value=0) 85 3e-17 SB_51759| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_53258| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_30783| Best HMM Match : RasGAP (HMM E-Value=3.2e-34) 30 1.2 SB_47095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45) 29 2.8 SB_20938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) 28 6.6 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) 28 6.6 SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) 27 8.7 SB_33521| Best HMM Match : Utp14 (HMM E-Value=0.48) 27 8.7 >SB_57277| Best HMM Match : Phage_T7_Capsid (HMM E-Value=6.7) Length = 130 Score = 101 bits (242), Expect = 4e-22 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = +3 Query: 171 GCTGLRASSTWWNNVQMGPPDVILGITEAYKKDTHPKKVNLGVGAYRDDEGKPFVLPSVR 350 G +R SS WW++V+ GPPD ILG+TEA+K+DT+PKK+NLGVGAYRDD GKP+VLPSV+ Sbjct: 42 GYAAVRLSS-WWSHVEAGPPDAILGVTEAFKRDTNPKKMNLGVGAYRDDTGKPYVLPSVK 100 Query: 351 KAEE 362 KA + Sbjct: 101 KASD 104 >SB_8675| Best HMM Match : Aminotran_1_2 (HMM E-Value=0) Length = 512 Score = 85.4 bits (202), Expect = 3e-17 Identities = 47/103 (45%), Positives = 62/103 (60%), Gaps = 6/103 (5%) Frame = +3 Query: 189 ASSTWWNNVQMGPPDVILGITEAYKKDTHPKKVNLGVGAYRDDEGKPFVLPSVRKAEEIL 368 AS+ + +V + P D + + Y KD P K+NLGVGAYRD++GKP+VLP V K E L Sbjct: 2 ASTNLFKDVPLVPTDHVFHVMACYNKDKDPSKINLGVGAYRDNDGKPWVLPVVSKVETQL 61 Query: 369 HSRG-----LNHEYAPISGEATYTDAVAKLAFGEDSPVI-KNR 479 ++G LNHEY I G ++DA KL G D P I +NR Sbjct: 62 -AQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAIAQNR 103 Score = 78.6 bits (185), Expect = 4e-15 Identities = 43/100 (43%), Positives = 60/100 (60%), Gaps = 5/100 (5%) Frame = +3 Query: 306 YRDDEGKPFVLPSVRKAEEILHSRG-----LNHEYAPISGEATYTDAVAKLAFGEDSPVI 470 YRD++GKP+VLP V K E L ++G LNHEY I G ++DA KL G D P I Sbjct: 106 YRDNDGKPWVLPVVSKVETQL-AQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAI 164 Query: 471 KNRSNCTVQTLSGTGALRLGLEFITKHYAKAKEIWLPTPT 590 C +Q++SGTG++ LGL+F+ + Y K ++ PT Sbjct: 165 AQNRVCGIQSISGTGSVFLGLKFLYQFY-NCKTAYISKPT 203 >SB_51759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 52.0 bits (119), Expect = 4e-07 Identities = 31/64 (48%), Positives = 39/64 (60%), Gaps = 6/64 (9%) Frame = +3 Query: 306 YRDDEGKPFVLPSVRKAEEILHSRG-----LNHEYAPISGEATYTDAVAKLAFGEDSPVI 470 YRD++GKP+VLP V K E L ++G LNHEY I G ++DA KL G D P I Sbjct: 2 YRDNDGKPWVLPVVSKVETQL-AQGIADGTLNHEYLGIDGLRQFSDAACKLLLGGDHPAI 60 Query: 471 -KNR 479 +NR Sbjct: 61 AQNR 64 >SB_53258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 31.1 bits (67), Expect = 0.70 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 455 RQSCHQK*EQLYCTDIVRHWRTPTRTRVHNETLR 556 +Q CH K EQL D+ ++T +++NET R Sbjct: 148 KQVCHDKYEQLPYDDVQNFFKTHISLKINNETFR 181 >SB_30783| Best HMM Match : RasGAP (HMM E-Value=3.2e-34) Length = 912 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -1 Query: 401 GSILMVESSTVKNFFCLSDRRQNKWFSLIVSICSNPKIYFFRMCVLLVCFCN 246 G ++ V S N L D+ + +S PK Y++ + + +CFCN Sbjct: 411 GRLIEVVHSHNLNAVLLPDQLSGRRPKWEISFLGLPKFYWYNIMIYAICFCN 462 >SB_47095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +3 Query: 231 DVILGITEAYKKDTHPKKVNLGVGAYRDDEGKPFVLPSVRKAEEILHSRGLNH 389 DV YK+D + NLGV AYR P +LP + +EI++++G+ + Sbjct: 84 DVACDSYHKYKEDVQLLR-NLGVKAYRFSISWPRILP--KGTKEIINTKGIEY 133 >SB_26078| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.45) Length = 671 Score = 29.1 bits (62), Expect = 2.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 346 TEGKTNGFPSSSLYAPTPRFTFL 278 ++ KT GF SSS P PRF F+ Sbjct: 377 SQEKTKGFDSSSWMKPNPRFMFM 399 >SB_20938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -2 Query: 520 SAPVPDNVCTVQLLLFLMTGLSSPKASLATASVYVASPLMGAYSWLS 380 + PV N+CTV ++ F++ GL +AT + V+ + W++ Sbjct: 24 AVPV-SNICTVFIIYFILRGLLHKTVKVATVARVVSDIIFSHPYWIT 69 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = -2 Query: 490 VQLLLFLMTGLSSPKASLATASVYVASPLMGAYSWLSPLL*RISSAFLTEGKTNGFPSSS 311 V + FLM GL+ +V V L+ A++W+S + + F ++ S Sbjct: 873 VNQVFFLMLGLNQISGFCVAVAVIVHYFLLAAFAWMSVMAYDVMKTFASKAVLQASNSRK 932 Query: 310 LYAP--TPRFTFLGCVSFL 260 + FTF V FL Sbjct: 933 TFIKYCCAAFTFPAIVVFL 951 >SB_42598| Best HMM Match : CtaG_Cox11 (HMM E-Value=0) Length = 1498 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = -1 Query: 371 VKNFFCLSDRRQNKWFSLIVSICSNPKIYFFRMCVLL--VCFCNA*DYIWRTHLNIVPPG 198 V +F+ L+ R+ +++FSL ++ ++ K + R+C + V A + W L+I P G Sbjct: 1142 VVHFYSLAQRKHSRYFSLAQALSNDSKSGYRRVCAFVHQVVRTAALTH-WALSLDISPKG 1200 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 312 DDEGKPFVLPSVRKAEEILHSRGLNHEYAPISGEA 416 D + KP + + +E +H++ + H+YA SGE+ Sbjct: 171 DIDQKPTANSKMDEKKEFIHAKYIKHQYAQKSGES 205 >SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) Length = 863 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 499 VCTVQLLLFLMTGLSSPKASLATASVYVASPLM 401 +CTV + L T L K SL S+Y+ PL+ Sbjct: 680 ICTVTMSLGFFTPLIPGKISLTLFSIYILLPLL 712 >SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 821 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 499 VCTVQLLLFLMTGLSSPKASLATASVYVASPLM 401 +CTV +L+ + T L K S+ +YV SPL+ Sbjct: 154 ICTVTILVGVFTPLIPLKISVTLFLIYVFSPLL 186 >SB_49500| Best HMM Match : Collagen (HMM E-Value=1.8e-07) Length = 621 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/52 (21%), Positives = 26/52 (50%) Frame = -2 Query: 481 LLFLMTGLSSPKASLATASVYVASPLMGAYSWLSPLL*RISSAFLTEGKTNG 326 + FLM G++S + ++ + L+ A+ W++ + + F +G+ G Sbjct: 568 VFFLMVGVNSVRGLCKVVAIGIHFFLLAAFLWMAVMAYDVHRTFTNQGEMTG 619 >SB_33521| Best HMM Match : Utp14 (HMM E-Value=0.48) Length = 947 Score = 27.5 bits (58), Expect = 8.7 Identities = 29/114 (25%), Positives = 48/114 (42%), Gaps = 6/114 (5%) Frame = +3 Query: 207 NNVQMGPPDVILGITEAYKKDTHPKKVNLGVGAYRDDEGKPFVLPSVRKAEEILHSRG-- 380 NN Q ++G+TE++KK + KK N G A V K +++ S Sbjct: 758 NNHQSDDIIKVVGVTESHKKKENKKKDNDGADA-------------VNKVIKVIESDDGH 804 Query: 381 LNHEYAPISGEATYTDAVAKLAFGEDSPVI----KNRSNCTVQTLSGTGALRLG 530 +N E PI+ + + + KL D + + S V + SG+G+ G Sbjct: 805 VNEEEGPITNHSDDVNEIIKLVESRDGHMTITDESSESGLLVDSGSGSGSKESG 858 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,003,047 Number of Sequences: 59808 Number of extensions: 410581 Number of successful extensions: 938 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -