BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b06f (552 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0382 - 5076673-5077774,5078122-5078186 29 1.9 05_01_0234 - 1743784-1744017,1748103-1749068 28 4.3 01_07_0359 - 43042675-43042758,43042956-43043024,43043099-430431... 27 7.5 06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876,440... 27 10.0 05_03_0653 + 16617121-16617359,16618892-16618955,16619455-166194... 27 10.0 >04_01_0382 - 5076673-5077774,5078122-5078186 Length = 388 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 Query: 339 KVKPTPPPVRRTLANCVDPRTRTALTRLP 253 K PTPPP RR N +D R + RLP Sbjct: 256 KKLPTPPPKRRLGINMLDGRNKLVEYRLP 284 >05_01_0234 - 1743784-1744017,1748103-1749068 Length = 399 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = -1 Query: 288 DPRTRTA-LTRLPAGAVNLTLTTRELIVAARLTTKLRKSLSLEVILPILKALALSVDLGS 112 DP+ A ++L V + + R+ L +LRKSL + +I P L+ ALSV+ + Sbjct: 196 DPKANIASASQLRGLGVKIRMAKRDR--GGILDVRLRKSLEIRLIPPELEVPALSVEEAT 253 Query: 111 ATSL 100 A L Sbjct: 254 AVLL 257 >01_07_0359 - 43042675-43042758,43042956-43043024,43043099-43043159, 43043260-43043768,43044545-43045153,43045697-43045972, 43046581-43046769,43047006-43047116,43047621-43047908, 43047990-43048041,43048648-43048824,43049249-43049314, 43049675-43049929,43050071-43050577,43050807-43050886, 43050974-43051207 Length = 1188 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 345 FTKVKPTPPPVRRTLANCVDPRTRTALTRLPAGAVN 238 F+ + P P+RR +A+C+ P T P A + Sbjct: 32 FSSARKPPEPLRRAVADCLSPPAPHTHTHAPPPAAS 67 >06_01_0609 + 4404287-4405023,4405496-4405631,4405724-4405876, 4405985-4406128,4406224-4406375,4406453-4406552, 4406653-4406775,4406876-4407037,4407190-4407247, 4407324-4407502,4408294-4408402,4408567-4408637, 4408891-4408986,4409727-4409803,4410983-4411066, 4411473-4411607,4411744-4411819,4413072-4413167, 4413580-4413671,4413745-4413868,4413966-4414052 Length = 996 Score = 27.1 bits (57), Expect = 10.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 342 TKVKPTPPPVRRTLANCVDPRTRT 271 T VKPTP P R+ A P+T T Sbjct: 78 TPVKPTPTPKRKRAAPSPSPKTPT 101 >05_03_0653 + 16617121-16617359,16618892-16618955,16619455-16619485, 16619577-16619848,16620528-16620633,16620715-16620872, 16621527-16621714,16621786-16621855,16622814-16622984, 16624363-16624838,16625625-16625871,16626158-16626490, 16627329-16627412,16627751-16627843,16627966-16628025, 16628582-16628680,16628830-16628970,16629207-16629287, 16629895-16629966,16631160-16631231,16632083-16632176, 16632257-16632339,16632455-16632532,16632914-16632970, 16633055-16633132,16633236-16633357,16633463-16633623, 16634419-16634495,16634570-16634683,16634857-16634958, 16635368-16635436,16635437-16635577,16635936-16636109, 16636934-16637063,16637137-16637276,16637369-16637446, 16637813-16637911,16638408-16638803 Length = 1749 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 324 PPPVRRTLANCVDPRTRTALTRLPAGAVNLTLTTRELI 211 PP + + V PRTRT+L+ LP + L L T L+ Sbjct: 1694 PPHIVSSAIEKVKPRTRTSLSMLP--LLRLLLPTTHLV 1729 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,262,843 Number of Sequences: 37544 Number of extensions: 218752 Number of successful extensions: 602 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 601 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -