BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b02f (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.0 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.0 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 364 FLGGVVMTILNLQYGYILRDDTMIQVNMFGLAL 462 FLG + + +LNL Y + D + ++F L + Sbjct: 331 FLGLIRLIVLNLSYNMLTHIDARMFKDLFFLQI 363 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,277 Number of Sequences: 438 Number of extensions: 3071 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -