BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b01r (716 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 29 0.11 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 1.8 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 1.8 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 1.8 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.4 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 29.5 bits (63), Expect = 0.11 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -3 Query: 384 AKKTVDKEAQIFCHNTNMAVKYDNNNLQMLDKDSCQVFLPS*HLFHE 244 AK+T+ HN N+ V+Y ++ +DK C+ L HE Sbjct: 334 AKETIHFALPELLHNLNLMVEYCEQDIITIDKQKCEAKDREEQLLHE 380 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -1 Query: 353 YFVIIQIWRSNMTIIIYRCWIKIAVKSFCHL 261 YF++ + +SN+ +++ W+ +A + HL Sbjct: 202 YFLLFSMVQSNLADVMFCSWLLLACEQLQHL 232 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -1 Query: 353 YFVIIQIWRSNMTIIIYRCWIKIAVKSFCHL 261 YF++ + +SN+ +++ W+ +A + HL Sbjct: 55 YFLLFSMVQSNLADVMFCSWLLLACEQLQHL 85 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 25.4 bits (53), Expect = 1.8 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -1 Query: 353 YFVIIQIWRSNMTIIIYRCWIKIAVKSFCHL 261 YF++ + +SN+ +++ W+ +A + HL Sbjct: 202 YFLLFSMVQSNLADVMFCSWLLLACEQLQHL 232 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -3 Query: 417 ENDCKINKNRNAKKTVDKEA 358 END K+N ++N ++T+ +A Sbjct: 1586 ENDSKLNSDQNKRRTMTLQA 1605 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,206 Number of Sequences: 2352 Number of extensions: 11627 Number of successful extensions: 73 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -