BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11b01f (642 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 26 1.2 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 3.6 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.7 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 6.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 8.2 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 8.2 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.8 bits (54), Expect = 1.2 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -2 Query: 332 PEAGSSPESRCASAGSNQTSRYRRIKTSGSSQWRRLQ---QTEAQSFHWCRRHGD 177 P S C + R R++ Q R+ QT +Q+ HW + HGD Sbjct: 182 PRVLESAAKFCEVLKGREMQRQFRLEQEQLQQMRKQSVDTQTLSQANHWLKSHGD 236 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.2 bits (50), Expect = 3.6 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +1 Query: 289 PAEAHRDSGEEPASGQRCCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAP--DRSYR 462 PA D+ G+ G S G + D DE H GRK AP R Sbjct: 616 PAGYREDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRK-GLAPLIQRGEG 674 Query: 463 SGEGKEQIP 489 S EGK P Sbjct: 675 SFEGKAMPP 683 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 524 KHTETCEKNPLPTKDVIE*ENQLEPL 601 K+T TCE LP +DV+ + E + Sbjct: 477 KNTTTCEDYALPYQDVVPSDPSFEDM 502 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.4 bits (48), Expect = 6.2 Identities = 13/51 (25%), Positives = 27/51 (52%) Frame = -3 Query: 580 LLNDVLCGERVLLARFRVLQLSGIEVLDAVQEFVLFLLRFDSFDRGQWILF 428 +L+ + G V+ A + ++ + V+D V+F + F +F+ G WI + Sbjct: 409 MLHAIKRGASVIKAS--IPKIKDVNVIDKYSR-VIFPVSFAAFNAGYWIFY 456 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -3 Query: 538 RFRVLQLSGIEVLDAVQEFVLFLLRFDS 455 R ++ L +E+++ +Q+F F FD+ Sbjct: 7 RVKMFNLKRVEIMNTLQDFEEFTKSFDA 34 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -2 Query: 371 GSGGLSPLRQHLCPEAGSSPESRCASAGSNQTSRY 267 G G SP+ H+ P + S S SN S Y Sbjct: 197 GGGPNSPISSHMGPNSPMSSVSSPGPISSNPQSPY 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,439 Number of Sequences: 2352 Number of extensions: 12718 Number of successful extensions: 35 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63141405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -