Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fmgV11a22f
         (622 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to A...    31   0.47 

>At2g07741.1 68415.m00991 ATPase subunit 6, putative similar to
           ATPase subunit 6 GI:515963 from [Raphanus sativus];
           contains Pfam profile: PF00119 ATP synthase, A subunit
          Length = 385

 Score = 31.5 bits (68), Expect = 0.47
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +3

Query: 426 PYIFTRTRHXXXXXXXXXXXXXXXXXYG*IKNTNHIFIHIIPQGTPYILIPFIVIIGTI 602
           PY FT T H                  G  ++  H F  ++P G P  L PF+V++  I
Sbjct: 241 PYSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELI 299


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,039,333
Number of Sequences: 28952
Number of extensions: 122729
Number of successful extensions: 244
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 243
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 244
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)