BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11a20r (771 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0550 + 17054155-17054182,17054438-17054503,17054504-17056959 29 3.1 09_04_0600 + 18883094-18883393,18883606-18883755,18883851-188841... 29 5.4 >04_03_0550 + 17054155-17054182,17054438-17054503,17054504-17056959 Length = 849 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 565 KVYFHSTHTELSQRTVTLXFLDPQVFIGLQILHLLHP 675 +VYF++ +L+ T+ L VFIGL +L L P Sbjct: 14 RVYFYAFDIDLASSTLVTGMLSVHVFIGLLLLSLHAP 50 >09_04_0600 + 18883094-18883393,18883606-18883755,18883851-18884142, 18884697-18884858,18884958-18885021,18887573-18888080 Length = 491 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -1 Query: 558 SLMVSKLKYXVNSHVSSNLLNYRDSTTFSIEIISPKYSC 442 S M L+ V H S +L Y D+TT+ + + +P +C Sbjct: 450 SRMRLALQLCVRRHTSWCMLLYSDTTTYGLNVTAPSGAC 488 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,611,914 Number of Sequences: 37544 Number of extensions: 195151 Number of successful extensions: 224 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 224 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -